PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AA21G00298 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 143aa MW: 16729.2 Da PI: 10.4193 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 101.9 | 2.3e-32 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRrng+lKKA+ELSvLCd+eva+iifss+gklye+s+ AA21G00298 10 RIENKINRQVTFSKRRNGLLKKAYELSVLCDVEVALIIFSSRGKLYEFSN 59 8***********************************************95 PP | |||||||
2 | K-box | 66.6 | 8.3e-23 | 79 | 141 | 6 | 69 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69 ++ e +++++qe+++Lk+++e+L r++R+llGedL+++slkeLq +e+qLe++l+ R++K AA21G00298 79 TN-RLEDSTQNWSQEVTRLKSKYESLVRTNRNLLGEDLGEMSLKELQMVEKQLETALTATRNRK 141 33.445559******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 33.067 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.3E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.09E-33 | 2 | 90 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.16E-42 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 1.1E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.1E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 2.7E-18 | 83 | 141 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 10.89 | 86 | 143 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048437 | Biological Process | floral organ development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MGRGKVEVRR IENKINRQVT FSKRRNGLLK KAYELSVLCD VEVALIIFSS RGKLYEFSNL 60 GIARTIERYQ RCHNYSKDTN RLEDSTQNWS QEVTRLKSKY ESLVRTNRNL LGEDLGEMSL 120 KELQMVEKQL ETALTATRNR KVV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 2e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 2e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 2e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Forms a heterodimer via the K-box domain with AG, that could be involved in genes regulation during floral meristem development. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00315 | DAP | Transfer from AT2G45650 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AA21G00298 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006397743.1 | 6e-78 | agamous-like MADS-box protein AGL6 | ||||
Swissprot | P29386 | 8e-77 | AGL6_ARATH; Agamous-like MADS-box protein AGL6 | ||||
TrEMBL | A0A087H5F2 | 4e-77 | A0A087H5F2_ARAAL; Uncharacterized protein | ||||
STRING | A0A087H5F2 | 6e-78 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4302 | 26 | 54 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 3e-79 | AGAMOUS-like 6 |
Publications ? help Back to Top | |||
---|---|---|---|
|