PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Aan012518 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 89aa MW: 9810.14 Da PI: 10.807 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 52.5 | 2e-16 | 57 | 89 | 3 | 35 |
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdL 35 + k++++++hTkv+gR+RR+R++a+caar+F+L Aan012518 57 APKRSTKDRHTKVDGRGRRIRMPATCAARVFQL 89 6799****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 3.6E-12 | 61 | 89 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 15.163 | 62 | 89 | IPR017887 | Transcription factor TCP subgroup |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MEPTNNHYQQ QQQALPMVAP SATSPPVDPS LAIATRSEEP IKENNQQVAT VTPPPPAPKR 60 STKDRHTKVD GRGRRIRMPA TCAARVFQL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Can specifically bind site II elements in the promoter region of PP438/PNM1. {ECO:0000269|PubMed:21297037}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024980203.1 | 1e-21 | transcription factor TCP8 | ||||
Swissprot | Q9C518 | 4e-15 | TCP8_ARATH; Transcription factor TCP8 | ||||
TrEMBL | A0A2U1PFL0 | 1e-42 | A0A2U1PFL0_ARTAN; Transcription factor, TCP | ||||
STRING | XP_004485466.1 | 3e-20 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G58100.1 | 3e-17 | TCP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|