PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
TF ID | Aan011841 | ||||||||||||
Organism | |||||||||||||
Taxonomic ID | |||||||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Anthemideae; Artemisiinae; Artemisia
|
||||||||||||
Family | Dof | ||||||||||||
Protein Properties | Length: 115aa MW: 12714.2 Da PI: 9.5196 | ||||||||||||
Description | Dof family protein | ||||||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 118.6 | 2.3e-37 | 13 | 68 | 3 | 58 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 +++l+cprCds+ntkfCyynny+lsqPr++Ck+CrryWtkGG+lr +P+Ggg rk Aan011841 13 HEKLNCPRCDSANTKFCYYNNYNLSQPRHYCKNCRRYWTKGGTLRKIPIGGGVRKG 68 6899**************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-21 | 5 | 57 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.3E-32 | 14 | 68 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.82 | 16 | 70 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 18 | 54 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MQQNQNHLQF PEHEKLNCPR CDSANTKFCY YNNYNLSQPR HYCKNCRRYW TKGGTLRKIP 60 IGGGVRKGGS KRVKPSADVA EDNIPVKTEE GESTSGGGGL NFGLSIFGSS GSKVD |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006426477.1 | 3e-35 | dof zinc finger protein DOF3.1 | ||||
Swissprot | O82155 | 6e-36 | DOF17_ARATH; Dof zinc finger protein DOF1.7 | ||||
TrEMBL | A0A2U1PGT0 | 4e-55 | A0A2U1PGT0_ARTAN; Dof zinc finger protein DOF3.1 | ||||
STRING | XP_006426477.1 | 1e-34 | (Citrus clementina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G51700.1 | 6e-30 | DOF zinc finger protein 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|