PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK40095.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 112aa MW: 12531.8 Da PI: 4.4375 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 43.5 | 8.1e-14 | 42 | 91 | 1 | 50 |
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqC 50 rW++ e+laL+++r+em++++r++ lk+plWee+++ +++ +e++ k+ KFK40095.1 42 RWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEIARSSSRKEIEKEEKEL 91 8*************************************999999988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF13837 | 1.8E-7 | 41 | 104 | No hit | No description |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MSVNSSGPLD SSGGVIGSSD EEEKDMKMEE TGDRGGGGGG NRWPRPETLA LLRIRSEMDK 60 AFRDSTLKAP LWEEIARSSS RKEIEKEEKE LERIVYEVDK RVNGEAREET TE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specific DNA sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK40095.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006300884.2 | 5e-24 | trihelix transcription factor GT-2 | ||||
Refseq | XP_010533325.1 | 3e-24 | PREDICTED: trihelix transcription factor GT-2-like, partial | ||||
Swissprot | Q39117 | 6e-23 | TGT2_ARATH; Trihelix transcription factor GT-2 | ||||
TrEMBL | A0A087HD93 | 7e-72 | A0A087HD93_ARAAL; Uncharacterized protein | ||||
STRING | A0A087HD92 | 4e-47 | (Arabis alpina) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G76890.2 | 1e-19 | Trihelix family protein |