PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK33687.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 238aa MW: 27161.8 Da PI: 7.9354 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.1 | 2e-18 | 15 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd llv++v+ +G++ W+ Ia+++ gR +kqc++rw+++l KFK33687.1 15 KGQWTSEEDRLLVQLVESHGTKKWSQIAKMLE-GRVGKQCRERWHNHL 61 799*****************************.*************97 PP | |||||||
2 | Myb_DNA-binding | 52.8 | 9.1e-17 | 67 | 109 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++ W++eEd +l++a+k+ G++ W+ ar+++ gRt++ +k++w+ KFK33687.1 67 KDVWSEEEDRILIEAHKEIGNK-WAEMARKLP-GRTENTIKNHWN 109 578*******************.*********.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 30.051 | 10 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.7E-32 | 12 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.4E-16 | 14 | 63 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-28 | 16 | 68 | IPR009057 | Homeodomain-like |
Pfam | PF13921 | 1.6E-17 | 18 | 72 | No hit | No description |
CDD | cd00167 | 9.70E-15 | 18 | 61 | No hit | No description |
PROSITE profile | PS51294 | 19.581 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 2.3E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.5E-21 | 69 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.42E-11 | 70 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010439 | Biological Process | regulation of glucosinolate biosynthetic process | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:1904095 | Biological Process | negative regulation of endosperm development | ||||
GO:2000692 | Biological Process | negative regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MRRGCKSIKK ANIIKGQWTS EEDRLLVQLV ESHGTKKWSQ IAKMLEGRVG KQCRERWHNH 60 LRPDIKKDVW SEEEDRILIE AHKEIGNKWA EMARKLPGRT ENTIKNHWNA TKRRQHSRRA 120 KGKDEISLAL GSNTLQNYIR SVTYNDDTLL TMSSTNANPN DGPENMREEG TQTLPLELMT 180 TTCESGSSST CDSVSVSRSG VTTEIDEPMT DSWMVMHGCD EVMLKEIALL EMIAHGRL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-46 | 13 | 115 | 2 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-46 | 13 | 115 | 2 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 1e-46 | 13 | 115 | 2 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes (PubMed:27681170, PubMed:25194028, PubMed:19066902). Promotes vegetative-to-embryonic transition and the formation of somatic embryos from root explants in a WUS-independent manner but via the expression of embryonic genes (e.g. LEC1, LEC2, FUS3 and WUS) (PubMed:18695688). May play an important role during embryogenesis and seed maturation (PubMed:19066902, PubMed:25194028). Together with MYB115, activates the transcription of S-ACP-DES2/AAD2 and S-ACP-DES3/AAD3 thus promoting the biosynthesis of omega-7 monounsaturated fatty acid in seed endosperm (PubMed:27681170). Regulates negatively maturation genes in the endosperm (PubMed:25194028). {ECO:0000269|PubMed:18695688, ECO:0000269|PubMed:19066902, ECO:0000269|PubMed:25194028, ECO:0000269|PubMed:27681170}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00385 | DAP | Transfer from AT3G27785 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK33687.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by LEC2. {ECO:0000269|PubMed:25194028}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010425555.1 | 1e-120 | PREDICTED: transcription factor MYB98-like | ||||
Swissprot | Q9LVW4 | 1e-119 | MY118_ARATH; Transcription factor MYB118 | ||||
TrEMBL | A0A087GUY5 | 1e-175 | A0A087GUY5_ARAAL; Uncharacterized protein | ||||
STRING | A0A087GUY5 | 1e-176 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6052 | 26 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G27785.1 | 1e-119 | myb domain protein 118 |
Publications ? help Back to Top | |||
---|---|---|---|
|