PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KFK27107.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 154aa MW: 16926.9 Da PI: 9.1912 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 51.9 | 1.8e-16 | 25 | 72 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+ Ede+l+ +v++ G g+W+++ + g+ R++k+c++rw ++l KFK27107.1 25 KGPWTAAEDEILAAYVRENGEGNWNAVQKNTGLARCGKSCRLRWANHL 72 79******************************************9996 PP | |||||||
2 | Myb_DNA-binding | 22.9 | 2e-07 | 78 | 105 | 1 | 29 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIar 29 +g++T +E+ l++++++qlG++ W++ a+ KFK27107.1 78 KGSFTSDEERLIIQLHAQLGNK-WARMAA 105 799*******************.**9885 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 21.318 | 20 | 76 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.9E-22 | 23 | 75 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.6E-12 | 24 | 74 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.2E-15 | 25 | 72 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 9.77E-24 | 26 | 102 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.91E-11 | 27 | 72 | No hit | No description |
PROSITE profile | PS50090 | 6.075 | 73 | 104 | IPR017877 | Myb-like domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-12 | 76 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9 | 77 | 148 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 9.1E-6 | 78 | 105 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MMMYGGVGKD GGSTNHVDGG VMLKKGPWTA AEDEILAAYV RENGEGNWNA VQKNTGLARC 60 GKSCRLRWAN HLRPNLKKGS FTSDEERLII QLHAQLGNKW ARMAAQDVFE EAEALAGGGG 120 DRPPKRRQLT ASPPNHQISS NYNNNNNNDN FFSI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1mse_C | 1e-20 | 22 | 104 | 1 | 82 | C-Myb DNA-Binding Domain |
1msf_C | 1e-20 | 22 | 104 | 1 | 82 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 121 | 126 | RPPKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KFK27107.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269|PubMed:19714218}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB017059 | 7e-98 | AB017059.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K13P22. | |||
GenBank | CP002688 | 7e-98 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
GenBank | KC544014 | 7e-98 | KC544014.1 Arabidopsis thaliana transcription factor MYB120 (MYB120) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009120026.1 | 1e-59 | PREDICTED: transcription factor MYB26-like | ||||
Swissprot | Q94FL7 | 2e-59 | MY120_ARATH; Transcription factor MYB120 | ||||
TrEMBL | A0A087GB55 | 1e-111 | A0A087GB55_ARAAL; Uncharacterized protein | ||||
STRING | A0A087GB55 | 1e-112 | (Arabis alpina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G55020.1 | 1e-61 | myb domain protein 120 |
Publications ? help Back to Top | |||
---|---|---|---|
|