PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | mrna26148.1-v1.0-hybrid | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 115aa MW: 13507.3 Da PI: 9.4864 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 41.7 | 2.5e-13 | 34 | 92 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +r +r+++NRe+ArrsR RKk++i+eL+ +v++L N +L ++l +l + ++ +e+ mrna26148.1-v1.0-hybrid 34 RRLKRLISNRESARRSRMRKKKQIQELKHEVDQLYVANNQLYEKLIRLLEVNQRILQEN 92 789********************************************999998888876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 6.8E-9 | 30 | 94 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.473 | 32 | 95 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 3.3E-12 | 34 | 92 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.73E-11 | 34 | 83 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 6.1E-11 | 34 | 102 | No hit | No description |
CDD | cd14702 | 1.25E-11 | 35 | 83 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 37 | 52 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MSHFNDISPY TYTVSTNTVF DETAAAEQSL NHERRLKRLI SNRESARRSR MRKKKQIQEL 60 KHEVDQLYVA NNQLYEKLIR LLEVNQRILQ ENAELKERVS SLQVTFTDLI DVTL* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | mrna26148.1-v1.0-hybrid |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004301090.1 | 2e-77 | PREDICTED: basic leucine zipper 43 | ||||
TrEMBL | M5WVR4 | 4e-44 | M5WVR4_PRUPE; Uncharacterized protein | ||||
STRING | XP_004301090.1 | 7e-77 | (Fragaria vesca) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF13044 | 24 | 30 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60830.1 | 1e-27 | basic leucine-zipper 70 |
Link Out ? help Back to Top | |
---|---|
Phytozome | mrna26148.1-v1.0-hybrid |