PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016492403.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 209aa MW: 23341.4 Da PI: 7.261 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 218.1 | 2.7e-67 | 13 | 173 | 2 | 170 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes.hldeslkee...lleelkveeenlksnvekeesa 92 d+ seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll s ll++ + h+++++ + +lee +++ n+ + ++++ XP_016492403.1 13 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLP------SLLLPSDNhHFGHTYFSPshnILEEITNATPNFLM----NQCN 97 577899***************************************8......45555554145666655512244444444444444....4444 PP YABBY 93 stsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 st+ + +++pr+p ++rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+i fgl XP_016492403.1 98 STDFVLP--ARPGFDDLPRPPVINRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQFGL 173 4444432..3567789***999******************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.4E-64 | 17 | 173 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 3.67E-8 | 117 | 167 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 7.1E-5 | 121 | 167 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 209 aa Download sequence Send to blast |
MSSSTPNSTC SLDHLPPSEQ LCYVHCNICD TVLAVSVPCT SLFKTVTVRC GHCTNLLPSL 60 LLPSDNHHFG HTYFSPSHNI LEEITNATPN FLMNQCNSTD FVLPARPGFD DLPRPPVINR 120 PPEKRQRVPS AYNRFIKEEI QRIKAGNPDI SHREAFSAAA KNWAHFPHIQ FGLMPDQTVK 180 RANVRQQDGE DVLMKDGLFT SANVSVSPY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ667760 | 0.0 | KJ667760.1 Solanum sisymbriifolium YAB1 protein mRNA, complete cds. | |||
GenBank | KJ667761 | 0.0 | KJ667761.1 Solanum aethiopicum YAB1 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009600360.1 | 1e-156 | PREDICTED: axial regulator YABBY 1-like | ||||
Refseq | XP_016492403.1 | 1e-156 | PREDICTED: axial regulator YABBY 1-like | ||||
Swissprot | O22152 | 7e-77 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | A0A1S4BUA2 | 1e-154 | A0A1S4BUA2_TOBAC; axial regulator YABBY 1-like | ||||
STRING | XP_009600360.1 | 1e-155 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA381 | 24 | 163 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 2e-74 | YABBY family protein |