PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010921842.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 171aa MW: 19323.9 Da PI: 8.3903 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 151 | 2.3e-47 | 32 | 126 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 +eq ++lPianv+rimk++lP+nakisk aket+qec+sefisfvt+easd+c +++rktingdd++ a+ tlG+++y++++k+yl +yre e++ XP_010921842.1 32 SEQSHLLPIANVGRIMKQALPQNAKISKRAKETIQECASEFISFVTEEASDRCCKDNRKTINGDDICCAMKTLGLDEYADAMKIYLCRYREHEEK 126 6999***************************************************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.1E-44 | 31 | 143 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.54E-35 | 35 | 134 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.9E-25 | 38 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.0E-13 | 65 | 83 | No hit | No description |
PRINTS | PR00615 | 1.0E-13 | 84 | 102 | No hit | No description |
PRINTS | PR00615 | 1.0E-13 | 103 | 121 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MDTSIDGQPY FRVRNSNVPR ATASTTPYGC TSEQSHLLPI ANVGRIMKQA LPQNAKISKR 60 AKETIQECAS EFISFVTEEA SDRCCKDNRK TINGDDICCA MKTLGLDEYA DAMKIYLCRY 120 REHEEKATSM KCNKPVQIDV NNELPIFQSS QSRDQLPSRS PQNAAKTRKF F |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 4e-38 | 33 | 122 | 3 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 4e-38 | 33 | 122 | 3 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010921842.1 | 1e-126 | nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 7e-41 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
Swissprot | O82248 | 7e-41 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2H3ZGK7 | 1e-107 | A0A2H3ZGK7_PHODC; nuclear transcription factor Y subunit B-4-like | ||||
STRING | XP_008813182.1 | 1e-108 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 3e-43 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|