PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010552588.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 95aa MW: 10832.2 Da PI: 10.0218 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 24.5 | 5e-08 | 21 | 61 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + ++L+ l+P++ + +s K+s + +L+++++YIk+L XP_010552588.1 21 DQIADLVSKLQLLIPELRRRRSDKVSASKVLQETCNYIKNL 61 6899999*********889********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 9.585 | 7 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 1.7E-8 | 21 | 84 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 1.7E-5 | 21 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 7.5E-8 | 21 | 76 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0080113 | Biological Process | regulation of seed growth | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
MSSRRSRPSR QSSVNSRISE DQIADLVSKL QLLIPELRRR RSDKVSASKV LQETCNYIKN 60 LHREVDDLGD RLSELLASTD HNSPEAAIIR SLLNF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_010552588.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010552588.1 | 4e-61 | PREDICTED: transcription factor PRE6 | ||||
Swissprot | Q8GW32 | 1e-41 | PRE6_ARATH; Transcription factor PRE6 | ||||
TrEMBL | A0A151RGX8 | 3e-42 | A0A151RGX8_CAJCA; Transcription factor bHLH135 family | ||||
STRING | XP_010552588.1 | 2e-60 | (Tarenaya hassleriana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM259 | 28 | 225 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 5e-44 | bHLH family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|