PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009800523.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 75aa MW: 8678.48 Da PI: 4.0183 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 38.7 | 2.2e-12 | 28 | 67 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++++E+el+++ ++lG + W++Ia +++ gRt++++ +w XP_009800523.1 28 EFSEDEEELIIRMYNLLGER-WSLIAGRIP-GRTAEEIEKYW 67 69******************.*********.**********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.311 | 21 | 75 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-9 | 25 | 73 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.72E-9 | 27 | 68 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.7E-11 | 28 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 8.7E-15 | 28 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.17E-6 | 36 | 67 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MADSEQLSFS DYTPPDSQGK ISKEVETEFS EDEEELIIRM YNLLGERWSL IAGRIPGRTA 60 EEIEKYWDTR SSTSQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009800523.1 | 4e-48 | PREDICTED: MYB-like transcription factor ETC1 | ||||
Refseq | XP_016469221.1 | 4e-48 | PREDICTED: MYB-like transcription factor ETC1 | ||||
Swissprot | Q9LNI5 | 8e-16 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A1S3ZY51 | 1e-46 | A0A1S3ZY51_TOBAC; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A1U7YBM4 | 1e-46 | A0A1U7YBM4_NICSY; MYB-like transcription factor ETC1 | ||||
STRING | XP_009800523.1 | 2e-47 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6579 | 19 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 6e-16 | MYB_related family protein |