PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_009608098.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 166aa MW: 19270.4 Da PI: 9.6438 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 54.6 | 1.4e-17 | 10 | 50 | 2 | 42 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 +i n+s r+ t+ kR++g++KK +ELS+LC+++++ ii+s+ XP_009608098.1 10 FITNESARKATLKKRKKGLMKKVSELSTLCGIDACAIIYSP 50 89**************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 15.895 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 6.0E-19 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 1.01E-17 | 2 | 86 | No hit | No description |
SuperFamily | SSF55455 | 5.49E-23 | 2 | 96 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-7 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.5E-18 | 10 | 51 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-7 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
MTRSKVNLAF ITNESARKAT LKKRKKGLMK KVSELSTLCG IDACAIIYSP YDQDQPEVWP 60 SIMGAQRVLE EFKRMPEMEQ CKKMMNQESF IRQRIVKASE QLKKKQKENR KQEVIEVMYQ 120 CLTGKGLDNL ILTDLNDLGW LIDQNLKEIC KRIEDLKKGA SXCIYN |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 21 | 25 | KKRKK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009608098.1 | 1e-118 | PREDICTED: agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 8e-57 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | A0A1S3ZJU3 | 2e-86 | A0A1S3ZJU3_TOBAC; agamous-like MADS-box protein AGL80 | ||||
STRING | XP_009608098.1 | 1e-118 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1532 | 23 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 4e-48 | AGAMOUS-like 80 |
Publications ? help Back to Top | |||
---|---|---|---|
|