PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_6DL_F7015CE89.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 175aa MW: 19285.2 Da PI: 11.1396 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.1 | 4.4e-14 | 93 | 135 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r+rr++kNRe+A rsRqRK+ ++ eLe++v++L++ N++L+ Traes_6DL_F7015CE89.2 93 RRQRRMIKNRESAARSRQRKQSYMMELETEVAKLKERNEELQR 135 79************************************99974 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.7E-14 | 89 | 152 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.162 | 91 | 136 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 1.26E-20 | 93 | 139 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 8.6E-16 | 93 | 136 | No hit | No description |
Pfam | PF00170 | 1.8E-12 | 93 | 135 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.5E-12 | 93 | 137 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 96 | 111 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MLFPQSNMFA PMVNPLSLAN GLMTGAYGQG GGGGGGAPAM VSPSPTGRPV MSNGYGKMEG 60 LNLSSLSPPP MPYVFSGGLR GRKPPAMEKV VERRQRRMIK NRESAARSRQ RKQSYMMELE 120 TEVAKLKERN EELQRKQFLV IGLSHPAAFN KVKVNQRENK SQNVFNYKST YSKSG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that mediates abscisic acid (ABA) signaling (PubMed:18931143, PubMed:19947981, PubMed:27424498, PubMed:27325665). Can regulate the expression of a wide spectrum of stress-related genes in response to abiotic stresses through an ABA-dependent regulation pathway. Confers ABA-dependent drought and salinity tolerance (PubMed:18931143, PubMed:27325665). Binds specifically to the ABA-responsive elements (ABRE) in the promoter of target genes to mediate stress-responsive ABA signaling (PubMed:27325665, PubMed:27424498). {ECO:0000269|PubMed:18931143, ECO:0000269|PubMed:19947981, ECO:0000269|PubMed:27325665, ECO:0000269|PubMed:27424498}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA) (PubMed:18315698, PubMed:18931143). Induced by drought, salt and osmotic stresses (PubMed:18931143). {ECO:0000269|PubMed:18315698, ECO:0000269|PubMed:18931143}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HQ622092 | 0.0 | HQ622092.1 Lophopyrum elongatum stress-related bZIP transcription factor (ABF6) mRNA, complete cds. | |||
GenBank | HQ738284 | 0.0 | HQ738284.1 Lophopyrum elongatum stress-related bZIP transcription factor (ABF6) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020164654.1 | 3e-78 | ABSCISIC ACID-INSENSITIVE 5-like protein 6 isoform X1 | ||||
Swissprot | Q6Z312 | 7e-53 | BZP23_ORYSJ; bZIP transcription factor 23 | ||||
TrEMBL | A0A453PRH5 | 1e-120 | A0A453PRH5_AEGTS; Uncharacterized protein | ||||
STRING | Traes_6DL_F7015CE89.2 | 1e-122 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP706 | 38 | 147 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G45249.1 | 2e-30 | abscisic acid responsive elements-binding factor 2 |