PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5AL_79E6A58E6.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 70aa MW: 8228.57 Da PI: 9.7493 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 39.2 | 1.5e-12 | 1 | 41 | 10 | 50 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 ++kNRe+A rsR+RK+a++ eLe +v++L+ N++L + Traes_5AL_79E6A58E6.1 1 MIKNRESAARSRARKQAYTMELEAEVQKLKDLNQELVRKQA 41 68*******************************98865443 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57959 | 8.44E-10 | 1 | 44 | No hit | No description |
Pfam | PF00170 | 4.3E-10 | 1 | 42 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 8.9E-13 | 1 | 43 | No hit | No description |
SMART | SM00338 | 7.3E-4 | 1 | 57 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.944 | 1 | 43 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 1.63E-15 | 1 | 48 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 70 aa Download sequence Send to blast |
MIKNRESAAR SRARKQAYTM ELEAEVQKLK DLNQELVRKQ AEILEMQKRE VIDCLSSIPN 60 FPISMYRSTI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16463099}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and cold. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB193553 | 1e-78 | AB193553.1 Triticum aestivum WABI5 mRNA for bZIP transcription factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020177661.1 | 2e-23 | bZIP transcription factor TRAB1-like isoform X2 | ||||
Swissprot | Q9M7Q2 | 3e-19 | AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7 | ||||
TrEMBL | A0A446T4K3 | 1e-42 | A0A446T4K3_TRITD; Uncharacterized protein | ||||
STRING | Traes_5AL_79E6A58E6.1 | 2e-43 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP14602 | 10 | 20 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G19290.1 | 1e-21 | ABRE binding factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|