PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Traes_5AL_79E6A58E6.1

Organism

Triticum aestivum

Taxonomic ID

4565

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum

Family

bZIP

Protein Properties

Length: 70aa MW: 8228.57 Da PI: 9.7493

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Traes_5AL_79E6A58E6.1	genome	IWGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	39.2	1.5e-12	1	41	10	50
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 ++kNRe+A rsR+RK+a++ eLe +v++L+ N++L + Traes_5AL_79E6A58E6.1 1 MIKNRESAARSRARKQAYTMELEAEVQKLKDLNQELVRKQA 41 68*******************************98865443 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF57959	8.44E-10	1	44	No hit	No description
Pfam	PF00170	4.3E-10	1	42	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	8.9E-13	1	43	No hit	No description
SMART	SM00338	7.3E-4	1	57	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	8.944	1	43	IPR004827	Basic-leucine zipper domain
CDD	cd14707	1.63E-15	1	48	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 70 aa Download sequence Send to blast
MIKNRESAAR SRARKQAYTM ELEAEVQKLK DLNQELVRKQ AEILEMQKRE VIDCLSSIPN 60 FPISMYRSTI

Functional Description ? help Back to Top
Source	Description
UniProt	Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:11884679, ECO:0000269\|PubMed:15361142, ECO:0000269\|PubMed:16463099}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and cold. {ECO:0000269\|PubMed:10636868, ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:16284313, ECO:0000269\|PubMed:16463099}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB193553	1e-78	AB193553.1 Triticum aestivum WABI5 mRNA for bZIP transcription factor, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020177661.1	2e-23	bZIP transcription factor TRAB1-like isoform X2
Swissprot	Q9M7Q2	3e-19	AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBL	A0A446T4K3	1e-42	A0A446T4K3_TRITD; Uncharacterized protein
STRING	Traes_5AL_79E6A58E6.1	2e-43	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP14602	10	20

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G19290.1	1e-21	ABRE binding factor 4

Publications ? help Back to Top
Brenchley R, et al. Analysis of the bread wheat genome using whole-genome shotgun sequencing. Nature, 2012. 491(7426): p. 705-10 [PMID:23192148] Gao S, et al. ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis. Mol Plant, 2016. 9(9): p. 1272-1285 [PMID:27373216] Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions. Plant Mol. Biol., 2018. 97(1-2): p. 149-163 [PMID:29680877] Muñiz García MN,Cortelezzi JI,Fumagalli M,Capiati DA Expression of the Arabidopsis ABF4 gene in potato increases tuber yield, improves tuber quality and enhances salt and drought tolerance. Plant Mol. Biol., 2018. 98(1-2): p. 137-152 [PMID:30143991]