PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G19290.1

Common Name

ABF4, AREB2, BZIP38, MVI11.7

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 431aa MW: 46492.1 Da PI: 10.1974

Description

ABRE binding factor 4

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G19290.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	42.1	1.9e-13	353	404	5	56
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +r+rr++kNRe+A rsR+RK+a++ eLe ++++L++ N++L+k+ e+ ++ AT3G19290.1 353 RRQRRMIKNRESAARSRARKQAYTLELEAEIEKLKKTNQELQKKQAEMVEMQ 404 69***************************************97655554443 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	7.5E-11	349	414	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.726	351	400	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	5.6E-11	353	405	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	5.34E-10	353	402	No hit	No description
CDD	cd14707	5.61E-23	353	400	No hit	No description
Gene3D	G3DSA:1.20.5.170	2.9E-13	353	402	No hit	No description
PROSITE pattern	PS00036	0	356	371	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009651	Biological Process	response to salt stress
GO:0009738	Biological Process	abscisic acid-activated signaling pathway
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:1900057	Biological Process	positive regulation of leaf senescence
GO:1903648	Biological Process	positive regulation of chlorophyll catabolic process
GO:0005634	Cellular Component	nucleus
GO:0000976	Molecular Function	transcription regulatory region sequence-specific DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000005	anatomy	cultured plant cell
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 431 aa Download sequence Send to blast
MGTHINFNNL GGGGHPGGEG SSNQMKPTGS VMPLARQSSV YSLTFDELQN TLGGPGKDFG 60 SMNMDELLKS IWTAEEAQAM AMTSAPAATA VAQPGAGIPP PGGNLQRQGS LTLPRTISQK 120 TVDEVWKCLI TKDGNMEGSS GGGGESNVPP GRQQTLGEMT LEEFLFRAGV VREDNCVQQM 180 GQVNGNNNNG FYGNSTAAGG LGFGFGQPNQ NSITFNGTND SMILNQPPGL GLKMGGTMQQ 240 QQQQQQLLQQ QQQQMQQLNQ PHPQQRLPQT IFPKQANVAF SAPVNITNKG FAGAANNSIN 300 NNNGLASYGG TGVTVAATSP GTSSAENNSL SPVPYVLNRG RRSNTGLEKV IERRQRRMIK 360 NRESAARSRA RKQAYTLELE AEIEKLKKTN QELQKKQAEM VEMQKNELKE TSKRPWGSKR 420 QCLRRTLTGP W

Sequence ? help Back to Top

Protein Sequence Length: 431 aa Download sequence Send to blast

MGTHINFNNL GGGGHPGGEG SSNQMKPTGS VMPLARQSSV YSLTFDELQN TLGGPGKDFG  60
SMNMDELLKS IWTAEEAQAM AMTSAPAATA VAQPGAGIPP PGGNLQRQGS LTLPRTISQK  120
TVDEVWKCLI TKDGNMEGSS GGGGESNVPP GRQQTLGEMT LEEFLFRAGV VREDNCVQQM  180
GQVNGNNNNG FYGNSTAAGG LGFGFGQPNQ NSITFNGTND SMILNQPPGL GLKMGGTMQQ  240
QQQQQQLLQQ QQQQMQQLNQ PHPQQRLPQT IFPKQANVAF SAPVNITNKG FAGAANNSIN  300
NNNGLASYGG TGVTVAATSP GTSSAENNSL SPVPYVLNRG RRSNTGLEKV IERRQRRMIK  360
NRESAARSRA RKQAYTLELE AEIEKLKKTN QELQKKQAEM VEMQKNELKE TSKRPWGSKR  420
QCLRRTLTGP W

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.23993	0.0	flower\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	258026_at	0.0
Expression Atlas	AT3G19290	-
AtGenExpress	AT3G19290	-
ATTED-II	AT3G19290	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, leaves, flowers and immatures siliques. {ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:11884679}.

Functional Description ? help Back to Top
Source	Description
TAIR	bZIP transcription factor with specificity for abscisic acid-responsive elements (ABRE). Mediate ABA-dependent stress responses.
UniProt	Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:11884679, ECO:0000269\|PubMed:15361142, ECO:0000269\|PubMed:16463099}.

Function -- GeneRIF ? help Back to Top
CPK32 is an ABA signaling component that regulates the ABA-responsive gene expression via ABF4. [PMID: 16299177] AREB1, AREB2, and ABF3 are master transcription factors that regulate the ABRE-dependent expression of water-stress responsive genes in ABA signaling in response to water stresses in a cooperative manner. [PMID: 19947981] Data show that the HD-Zip protein Athb-21 and B-3 AP2/ERF transcription factor ESE1 are interact with the abscisic acid responsive element binding factor AREB2/ABF4, which binds to a G-box absolutely required for expression of the COX5b-1 gene. [PMID: 22669746] ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis [PMID: 27373216] the role of ABF1/3/4 in det1 germination phenotypes [PMID: 29680877] Besides enhancing salt stress and drought tolerance, constitutive expression of ABF4 increases tuber yield under normal and stress conditions, enhances storage capability and improves the processing quality of the tubers. [PMID: 30143991]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G19290.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA) and cold. {ECO:0000269\|PubMed:10636868, ECO:0000269\|PubMed:11005831, ECO:0000269\|PubMed:16284313, ECO:0000269\|PubMed:16463099}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT3G24650 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT5G52300(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT3G19290, AT3G23220, AT4G25480, AT4G34000, AT5G05410, AT1G45249, AT1G49720
IntAct	Search Q9M7Q2

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Defective in ABA and stress responses. {ECO:0000269\|PubMed:15361142}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G19290

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB017161	0.0	AB017161.1 Arabidopsis thaliana mRNA for ABA-responsive element binding protein 2 (AREB2), complete cds.
GenBank	AF093547	0.0	AF093547.1 Arabidopsis thaliana clone 19 abscisic acid responsive elements-binding factor (ABRE) mRNA, partial cds.
GenBank	AY050897	0.0	AY050897.1 Arabidopsis thaliana putative abscisic acid responsive elements-binding factor (At3g19290) mRNA, complete cds.
GenBank	AY091298	0.0	AY091298.1 Arabidopsis thaliana putative abscisic acid responsive elements-binding factor (At3g19290) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001326147.1	0.0	ABRE binding factor 4
Refseq	NP_566629.1	0.0	ABRE binding factor 4
Swissprot	Q9M7Q2	0.0	AI5L7_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBL	A0A178V7Z7	0.0	A0A178V7Z7_ARATH; AREB2
STRING	AT3G19290.3	0.0	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT3G19290.1
Entrez Gene	821463
iHOP	AT3G19290
wikigenes	AT3G19290

Publications ? help Back to Top
Choi H,Hong J,Ha J,Kang J,Kim SY ABFs, a family of ABA-responsive element binding factors. J. Biol. Chem., 2000. 275(3): p. 1723-30 [PMID:10636868] Finkelstein RR,Lynch TJ The Arabidopsis abscisic acid response gene ABI5 encodes a basic leucine zipper transcription factor. Plant Cell, 2000. 12(4): p. 599-609 [PMID:10760247] Uno Y, et al. Arabidopsis basic leucine zipper transcription factors involved in an abscisic acid-dependent signal transduction pathway under drought and high-salinity conditions. Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11632-7 [PMID:11005831] Riechmann JL,Ratcliffe OJ A genomic perspective on plant transcription factors. Curr. Opin. Plant Biol., 2000. 3(5): p. 423-34 [PMID:11019812] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Kang JY,Choi HI,Im MY,Kim SY Arabidopsis basic leucine zipper proteins that mediate stress-responsive abscisic acid signaling. Plant Cell, 2002. 14(2): p. 343-57 [PMID:11884679] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Im YJ,Han O,Chung GC,Cho BH Antisense expression of an Arabidopsis omega-3 fatty acid desaturase gene reduces salt/drought tolerance in transgenic tobacco plants. Mol. Cells, 2002. 13(2): p. 264-71 [PMID:12018849] Bensmihen S, et al. The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis. Plant Cell, 2002. 14(6): p. 1391-403 [PMID:12084834] Suzuki M,Ketterling MG,Li QB,McCarty DR Viviparous1 alters global gene expression patterns through regulation of abscisic acid signaling. Plant Physiol., 2003. 132(3): p. 1664-77 [PMID:12857845] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Kim S,Kang JY,Cho DI,Park JH,Kim SY ABF2, an ABRE-binding bZIP factor, is an essential component of glucose signaling and its overexpression affects multiple stress tolerance. Plant J., 2004. 40(1): p. 75-87 [PMID:15361142] Fujita Y, et al. AREB1 Is a transcription activator of novel ABRE-dependent ABA signaling that enhances drought stress tolerance in Arabidopsis. Plant Cell, 2005. 17(12): p. 3470-88 [PMID:16284313] Choi HI, et al. Arabidopsis calcium-dependent protein kinase AtCPK32 interacts with ABF4, a transcriptional regulator of abscisic acid-responsive gene expression, and modulates its activity. Plant Physiol., 2005. 139(4): p. 1750-61 [PMID:16299177] Furihata T, et al. Abscisic acid-dependent multisite phosphorylation regulates the activity of a transcription activator AREB1. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(6): p. 1988-93 [PMID:16446457] Nakashima K, et al. Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis. Plant Mol. Biol., 2006. 60(1): p. 51-68 [PMID:16463099] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Zhang Y, et al. SDIR1 is a RING finger E3 ligase that positively regulates stress-responsive abscisic acid signaling in Arabidopsis. Plant Cell, 2007. 19(6): p. 1912-29 [PMID:17573536] Zhu SY, et al. Two calcium-dependent protein kinases, CPK4 and CPK11, regulate abscisic acid signal transduction in Arabidopsis. Plant Cell, 2007. 19(10): p. 3019-36 [PMID:17921317] Garcia ME,Lynch T,Peeters J,Snowden C,Finkelstein R A small plant-specific protein family of ABI five binding proteins (AFPs) regulates stress response in germinating Arabidopsis seeds and seedlings. Plant Mol. Biol., 2008. 67(6): p. 643-58 [PMID:18484180] Comelli RN,Viola IL,Gonzalez DH Characterization of promoter elements required for expression and induction by sucrose of the Arabidopsis COX5b-1 nuclear gene, encoding the zinc-binding subunit of cytochrome c oxidase. Plant Mol. Biol., 2009. 69(6): p. 729-43 [PMID:19125337] Yoshida T, et al. AREB1, AREB2, and ABF3 are master transcription factors that cooperatively regulate ABRE-dependent ABA signaling involved in drought stress tolerance and require ABA for full activation. Plant J., 2010. 61(4): p. 672-85 [PMID:19947981] Lee SJ, et al. DREB2C interacts with ABF2, a bZIP protein regulating abscisic acid-responsive gene expression, and its overexpression affects abscisic acid sensitivity. Plant Physiol., 2010. 153(2): p. 716-27 [PMID:20395451] Kriegs B, et al. Cyclic monoterpene mediated modulations of Arabidopsis thaliana phenotype: effects on the cytoskeleton and on the expression of selected genes. Plant Signal Behav, 2010. 5(7): p. 832-8 [PMID:20484979] Kline KG,Barrett-Wilt GA,Sussman MR In planta changes in protein phosphorylation induced by the plant hormone abscisic acid. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(36): p. 15986-91 [PMID:20733066] Li G, et al. Two cotton Cys2/His2-type zinc-finger proteins, GhDi19-1 and GhDi19-2, are involved in plant response to salt/drought stress and abscisic acid signaling. Plant Mol. Biol., 2010. 74(4-5): p. 437-52 [PMID:20852918] Kim YY,Jung KW,Yoo KS,Jeung JU,Shin JS A stress-responsive caleosin-like protein, AtCLO4, acts as a negative regulator of ABA responses in Arabidopsis. Plant Cell Physiol., 2011. 52(5): p. 874-84 [PMID:21471120] Zhao R, et al. The Arabidopsis Ca(2+) -dependent protein kinase CPK12 negatively regulates abscisic acid signaling in seed germination and post-germination growth. New Phytol., 2011. 192(1): p. 61-73 [PMID:21692804] Rushton DL, et al. WRKY transcription factors: key components in abscisic acid signalling. Plant Biotechnol. J., 2012. 10(1): p. 2-11 [PMID:21696534] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Kim JS, et al. An ABRE promoter sequence is involved in osmotic stress-responsive expression of the DREB2A gene, which encodes a transcription factor regulating drought-inducible genes in Arabidopsis. Plant Cell Physiol., 2011. 52(12): p. 2136-46 [PMID:22025559] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Zhao R,Wang XF,Zhang DP CPK12: A Ca2+-dependent protein kinase balancer in abscisic acid signaling. Plant Signal Behav, 2011. 6(11): p. 1687-90 [PMID:22041934] Curran A, et al. Calcium-dependent protein kinases from Arabidopsis show substrate specificity differences in an analysis of 103 substrates. Front Plant Sci, 2011. 2: p. 36 [PMID:22645532] Comelli RN,Welchen E,Kim HJ,Hong JC,Gonzalez DH Delta subclass HD-Zip proteins and a B-3 AP2/ERF transcription factor interact with promoter elements required for expression of the Arabidopsis cytochrome c oxidase 5b-1 gene. Plant Mol. Biol., 2012. 80(2): p. 157-67 [PMID:22669746] Luo X, et al. Over-expression of GsZFP1, an ABA-responsive C2H2-type zinc finger protein lacking a QALGGH motif, reduces ABA sensitivity and decreases stomata size. J. Plant Physiol., 2012. 169(12): p. 1192-202 [PMID:22705253] Lynch T,Erickson BJ,Finkelstein RR Direct interactions of ABA-insensitive(ABI)-clade protein phosphatase(PP)2Cs with calcium-dependent protein kinases and ABA response element-binding bZIPs may contribute to turning off ABA response. Plant Mol. Biol., 2012. 80(6): p. 647-58 [PMID:23007729] Luo X, et al. Expression of wild soybean WRKY20 in Arabidopsis enhances drought tolerance and regulates ABA signalling. J. Exp. Bot., 2013. 64(8): p. 2155-69 [PMID:23606412] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Gao S, et al. ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis. Mol Plant, 2016. 9(9): p. 1272-1285 [PMID:27373216] Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions. Plant Mol. Biol., 2018. 97(1-2): p. 149-163 [PMID:29680877] Muñiz García MN,Cortelezzi JI,Fumagalli M,Capiati DA Expression of the Arabidopsis ABF4 gene in potato increases tuber yield, improves tuber quality and enhances salt and drought tolerance. Plant Mol. Biol., 2018. 98(1-2): p. 137-152 [PMID:30143991]