PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_5AL_047ABC9FC.1 | ||||||||
Common Name | NFYA-A2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 130aa MW: 14578.7 Da PI: 10.8554 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 100.3 | 1.9e-31 | 65 | 121 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 d+p+YVNaKQy++Il+RR +Rak+e+e++l k+rkpylheSRh+hA+rR+Rg+gGrF Traes_5AL_047ABC9FC.1 65 DAPIYVNAKQYEGILRRRRARAKVERENQL-VKGRKPYLHESRHRHAMRRARGTGGRF 121 68****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 6.1E-34 | 63 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.172 | 64 | 124 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 3.6E-28 | 67 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 4.0E-24 | 67 | 89 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 4.0E-24 | 98 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MEHSATIALQ SPLPEYNSRF EFGPGPSMMS SGYPSAEQCY GLLTTYAMKS TPGGRLLLPL 60 NATADAPIYV NAKQYEGILR RRRARAKVER ENQLVKGRKP YLHESRHRHA MRRARGTGGR 120 FLNTKKEGNG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 3e-20 | 65 | 129 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 105 | 114 | RHRHAMRRAR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KM078749 | 0.0 | KM078749.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-A2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020182505.1 | 3e-76 | nuclear transcription factor Y subunit A-10-like | ||||
Refseq | XP_020182506.1 | 3e-76 | nuclear transcription factor Y subunit A-10-like | ||||
Refseq | XP_020182507.1 | 3e-76 | nuclear transcription factor Y subunit A-10-like | ||||
Swissprot | Q8LFU0 | 2e-30 | NFYAA_ARATH; Nuclear transcription factor Y subunit A-10 | ||||
TrEMBL | A0A0A7LWR8 | 1e-88 | A0A0A7LWR8_WHEAT; CCAAT-binding transcription factor B | ||||
STRING | Traes_5AL_047ABC9FC.1 | 3e-91 | (Triticum aestivum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2307 | 37 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G14020.1 | 3e-25 | nuclear factor Y, subunit A6 |
Publications ? help Back to Top | |||
---|---|---|---|
|