PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG011736t1
Common NameTCM_011736
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bHLH
Protein Properties Length: 93aa    MW: 10419.7 Da    PI: 8.5213
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG011736t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH27.94.2e-0919591454
                      HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
               HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                      d+i +  ++L++l+P++ + +s K+s + +L+++++YI+sL
  Thecc1EG011736t1 19 DQITDLVSKLQQLIPELRGRRSDKVSASKVLQETCNYIRSL 59
                      6899999*********88*********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.280.102.1E-9374IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.652559IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474592.09E-91976IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.6E-61959IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MSSRRSRSRQ SGVSRITDDQ ITDLVSKLQQ LIPELRGRRS DKVSASKVLQ ETCNYIRSLH  60
REVDDLSDRL SELLASTDTD SDQAAIIRSL LM*
Functional Description ? help Back to Top
Source Description
UniProtAtypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269|PubMed:16786307, ECO:0000269|PubMed:23224238}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269|PubMed:16786307}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017970156.13e-57PREDICTED: transcription factor PRE6 isoform X2
SwissprotQ8GW324e-39PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A061EC237e-56A0A061EC23_THECC; Basic helix-loop-helix DNA-binding superfamily protein
STRINGEOY019571e-56(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.12e-41bHLH family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Gommers CM, et al.
    Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation.
    Plant Cell, 2017. 29(2): p. 331-344
    [PMID:28138015]
  4. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  5. Zheng K, et al.
    Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1813
    [PMID:29114256]