PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sobic.003G417700.1.p | ||||||||
Common Name | Sb03g045130, SORBIDRAFT_03g045130 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 147aa MW: 16215 Da PI: 7.561 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 145.6 | 1.1e-45 | 15 | 108 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90 r+++++lPianv+rimk +lP +akisk+aket+qec++ef++fvt+eas++c+re+rktingdd+++a+ +lG+++y+++++ yl++y Sobic.003G417700.1.p 15 RHDNNLLPIANVGRIMKDALPPQAKISKHAKETIQECATEFVGFVTGEASERCRRERRKTINGDDICHAMRSLGLDHYADSMHRYLQRY 103 78899************************************************************************************ PP NF-YB 91 releg 95 re+e+ Sobic.003G417700.1.p 104 RETEE 108 **985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-42 | 8 | 110 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 6.71E-33 | 17 | 112 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.3E-24 | 21 | 84 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.3E-13 | 48 | 66 | No hit | No description |
PRINTS | PR00615 | 2.3E-13 | 67 | 85 | No hit | No description |
PRINTS | PR00615 | 2.3E-13 | 86 | 104 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 147 aa Download sequence Send to blast |
MASSSTTQDA NNGVRHDNNL LPIANVGRIM KDALPPQAKI SKHAKETIQE CATEFVGFVT 60 GEASERCRRE RRKTINGDDI CHAMRSLGLD HYADSMHRYL QRYRETEELA ATLNNGGGGR 120 DGRAIQIDVR AELSIFKGSN QQDGRD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-37 | 14 | 105 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-37 | 14 | 105 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sobic.003G417700.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002459054.2 | 1e-106 | transcriptional activator hap3 | ||||
Swissprot | O04027 | 3e-41 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A1W0W1A6 | 1e-105 | A0A1W0W1A6_SORBI; Uncharacterized protein | ||||
STRING | Sb03g045130.1 | 1e-105 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 | Representative plant | OGRP168 | 17 | 170 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 1e-43 | nuclear factor Y, subunit B4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sobic.003G417700.1.p |
Entrez Gene | 8062277 |
Publications ? help Back to Top | |||
---|---|---|---|
|