PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sme2.5_02470.1_g00007.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 161aa MW: 19034.6 Da PI: 7.6561 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 93.4 | 3.8e-29 | 9 | 88 | 1 | 81 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 lppGfrFhPtdeel+++yL+ +++++++++ ++i+e+d+yk++Pw+Lp+k++ +e+ewyfF++rd+ky++g r+nra+ sg Sme2.5_02470.1_g00007.1 9 LPPGFRFHPTDEELIMYYLRYQATSRPFPI-SIIPEIDVYKFDPWELPEKAEFGENEWYFFTPRDRKYPNGVRPNRAAVSG 88 79****************************.89***************99999***********************98877 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.31E-47 | 5 | 132 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 29.841 | 9 | 147 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-11 | 10 | 105 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 161 aa Download sequence Send to blast |
MVGKINSDLP PGFRFHPTDE ELIMYYLRYQ ATSRPFPISI IPEIDVYKFD PWELPEKAEF 60 GENEWYFFTP RDRKYPNGVR PNRAAVSGKP PKGVKTDWIM HEYRLSDSKS QNTKQSGSMR 120 LDDWVLCRIY KKKNLGKTIE MMKVEEEEDV KAHQTERDSS H |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 3e-53 | 8 | 134 | 14 | 170 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EF091874 | 1e-104 | EF091874.1 Solanum tuberosum NAC domain protein NAC2 (NAC2) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015074984.1 | 6e-98 | NAC domain-containing protein 1 | ||||
Swissprot | K4BWV2 | 4e-98 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
TrEMBL | A0A1U8EJR9 | 4e-96 | A0A1U8EJR9_CAPAN; NAC transcription factor | ||||
TrEMBL | A0A2G2VLL0 | 1e-96 | A0A2G2VLL0_CAPBA; NAC transcription factor | ||||
TrEMBL | A0A2G2XY28 | 4e-96 | A0A2G2XY28_CAPAN; NAC transcription factor 29-like | ||||
TrEMBL | A0A2G3B7M0 | 3e-96 | A0A2G3B7M0_CAPCH; NAC transcription factor 29 | ||||
STRING | Solyc05g007770.2.1 | 2e-96 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA746 | 24 | 103 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 2e-74 | NAC-like, activated by AP3/PI |
Publications ? help Back to Top | |||
---|---|---|---|
|