PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Sevir.5G355500.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 214aa MW: 23464.4 Da PI: 6.3677 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 30.3 | 8.9e-10 | 73 | 114 | 9 | 50 |
CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 9 rkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 + NReA r++R++Kka + Lee+vk+L a N++L +l+ Sevir.5G355500.1.p 73 KPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQ 114 4455*********************************98887 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 2.7E-15 | 61 | 133 | No hit | No description |
SMART | SM00338 | 4.1E-10 | 65 | 132 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.726 | 67 | 114 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14686 | 4.03E-11 | 68 | 123 | No hit | No description |
SuperFamily | SSF57959 | 1.5E-7 | 69 | 115 | No hit | No description |
Pfam | PF07716 | 1.8E-11 | 73 | 122 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 214 aa Download sequence Send to blast |
MDNGVDLPIP SHLPLSHPEI SHGLDDFLKS TTACTHTHTC NPPGPAAAMH THTCLHTHTQ 60 VIASGEEQRK PQKPLGNREA VRKYREKKKA HAAFLEEEVK KLRATNQQLL RRLQGHAALE 120 AEVVRLRVLL FDVRGKIDAE IDSFPFQKHS SVDSVICTDP PLCFNTNAEV AARETSSGGP 180 TILDFEIDES GSVSRELDIP EVVNSMDAAA SYF* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Sevir.5G355500.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF184969 | 1e-170 | KF184969.1 Saccharum hybrid cultivar R570 clone BAC 045L22 complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004970277.1 | 1e-157 | basic leucine zipper 23 | ||||
Refseq | XP_004970278.1 | 1e-157 | basic leucine zipper 23 | ||||
Swissprot | Q8GTS2 | 7e-51 | BZP23_ARATH; Basic leucine zipper 23 | ||||
TrEMBL | K3XLX0 | 1e-155 | K3XLX0_SETIT; Uncharacterized protein | ||||
STRING | Si002893m | 1e-156 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3831 | 36 | 75 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16770.1 | 2e-40 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Sevir.5G355500.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|