PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.2371s0030.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 218aa MW: 25721.9 Da PI: 8.684 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.4 | 7e-18 | 4 | 49 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W Ede+l ++v+q+G+++W++Ia++++ gR++k+c++rw++ SapurV1A.2371s0030.1.p 4 RGHWRLAEDEKLRELVEQYGPHNWNSIAEKLQ-GRSGKSCRLRWFNQ 49 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 58.1 | 2e-18 | 56 | 99 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r ++T+eE+e+l+ +++ +G++ W+ Ia+ ++ gRt++ +k++w+ SapurV1A.2371s0030.1.p 56 RSPFTEEEEERLLACHRIHGNK-WAVIAKQFP-GRTDNAVKNHWHV 99 789*******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 18.763 | 1 | 50 | IPR017930 | Myb domain |
SMART | SM00717 | 8.6E-15 | 3 | 52 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 6.74E-30 | 4 | 97 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 5.9E-17 | 4 | 49 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-26 | 5 | 57 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.07E-13 | 7 | 48 | No hit | No description |
PROSITE profile | PS51294 | 25.797 | 51 | 105 | IPR017930 | Myb domain |
SMART | SM00717 | 1.1E-15 | 55 | 103 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.4E-16 | 56 | 98 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 7.9E-22 | 58 | 103 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.90E-11 | 58 | 98 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MSSRGHWRLA EDEKLRELVE QYGPHNWNSI AEKLQGRSGK SCRLRWFNQL DPRINRSPFT 60 EEEEERLLAC HRIHGNKWAV IAKQFPGRTD NAVKNHWHVI MARICRERSK IHAKTAARTL 120 LVNEQKPSFS NHQVVRIMNC ETRNISPSFV HEFFESYCDS YRHPFTLNYP SISKTFCNEN 180 RSPCEGKNQP LEFYDFLQVK TESSKSEVID NARRDDVE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-31 | 4 | 103 | 7 | 106 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269|PubMed:18952777, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:23781226}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.2371s0030.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:19674407, ECO:0000269|PubMed:21399993, ECO:0000269|PubMed:22197883}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB970791 | 1e-138 | AB970791.1 Populus tremula x Populus tremuloides PtxtMYB175 mRNA for MYB transcriptional factor, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002309771.1 | 1e-139 | transcription factor MYB54 | ||||
Refseq | XP_024461017.1 | 1e-139 | transcription factor MYB54 | ||||
Swissprot | Q6R0C4 | 7e-76 | MYB52_ARATH; Transcription factor MYB52 | ||||
TrEMBL | B9HGW9 | 1e-137 | B9HGW9_POPTR; MYB family protein | ||||
STRING | POPTR_0012s03650.1 | 1e-100 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF230 | 34 | 243 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17950.1 | 3e-78 | myb domain protein 52 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.2371s0030.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|