PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.1562s0030.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 247aa MW: 28311.5 Da PI: 7.5011 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 158.1 | 3.7e-49 | 14 | 140 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 lppGfrF+Pt+eelv +yL+ k+ + ++++ +vi+ev+++k++PwdLp e+e yfFs+++ ky++g+r nra +sg+Wkatg SapurV1A.1562s0030.1.p 14 LPPGFRFQPTEEELVFQYLRGKILSWPMPA-SVIPEVNVCKYDPWDLPGD---MEQERYFFSTKEAKYTKGNRVNRASSSGFWKATG 96 79****************************.99***************54...46799***************************** PP NAM 88 kdkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128 dk+++s+ ++++vg+kktLvfy+g+ap+g++tdWvmheyrl SapurV1A.1562s0030.1.p 97 LDKQIVSStrkNNHAVGMKKTLVFYRGKAPNGSRTDWVMHEYRL 140 ******987767777***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-55 | 10 | 178 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.039 | 14 | 178 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.7E-24 | 15 | 140 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 247 aa Download sequence Send to blast |
MEKFNFVRDG MSRLPPGFRF QPTEEELVFQ YLRGKILSWP MPASVIPEVN VCKYDPWDLP 60 GDMEQERYFF STKEAKYTKG NRVNRASSSG FWKATGLDKQ IVSSTRKNNH AVGMKKTLVF 120 YRGKAPNGSR TDWVMHEYRL VNLGEETTDC NFPQTENSAQ HNSSFQLDKW VVCRIFLKKK 180 GTATAEMTET WTNENDRGAQ PRLFDFMARD DIVFDSVSSS CSSSSNHADV SSNEQDHEQS 240 SSRNFY* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-45 | 14 | 179 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-45 | 14 | 179 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-45 | 14 | 179 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-45 | 14 | 179 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
3swm_B | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
3swm_C | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
3swm_D | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
3swp_A | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
3swp_B | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
3swp_C | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
3swp_D | 5e-45 | 14 | 179 | 20 | 169 | NAC domain-containing protein 19 |
4dul_A | 4e-45 | 14 | 179 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 4e-45 | 14 | 179 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.1562s0030.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024438680.1 | 1e-144 | NAC domain-containing protein 83 isoform X1 | ||||
Swissprot | Q9FY93 | 1e-71 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A2K1YBR1 | 1e-143 | A0A2K1YBR1_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0012s10530.1 | 1e-140 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 2e-73 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.1562s0030.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|