PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | SapurV1A.0063s0610.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 249aa MW: 28442.4 Da PI: 10.2809 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 171.2 | 3.2e-53 | 10 | 135 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 lppGfrFhPtdeel+v+yL+++++++++++ ++i+e+diyk++Pw+Lp+k++ +e+ewyfF++ d+ky++g r+nrat sgyWkatg SapurV1A.0063s0610.1.p 10 LPPGFRFHPTDEELIVYYLRNQATSRPCPA-SIIPEFDIYKFDPWQLPEKAEFGENEWYFFTPLDRKYPNGVRPNRATVSGYWKATG 95 79****************************.89***************99999********************************** PP NAM 88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +dk+++s +++ vg+kk Lvfykgr pkg+ktdW+m+eyrl SapurV1A.0063s0610.1.p 96 TDKAIHS-GSKYVGVKKALVFYKGRPPKGTKTDWIMQEYRL 135 *******.99*****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 8.5E-62 | 9 | 159 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.216 | 10 | 159 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.1E-26 | 11 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MQGKNNSGQL PPGFRFHPTD EELIVYYLRN QATSRPCPAS IIPEFDIYKF DPWQLPEKAE 60 FGENEWYFFT PLDRKYPNGV RPNRATVSGY WKATGTDKAI HSGSKYVGVK KALVFYKGRP 120 PKGTKTDWIM QEYRLNDSNK QAIKQKGSMR LVLCRIYRKR HAMRHLDEKT ENTVLAHLEV 180 TPATDAREQQ MMKIPRTCSI SQLLELDYLG SISQLLSGDT RKKQKKKGGR TRATHGGQSS 240 RPQCNESA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-62 | 10 | 162 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-62 | 10 | 162 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-62 | 10 | 162 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-62 | 10 | 162 | 17 | 168 | NO APICAL MERISTEM PROTEIN |
3swm_A | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
3swm_B | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
3swm_C | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
3swm_D | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
3swp_A | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
3swp_B | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
3swp_C | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
3swp_D | 5e-62 | 10 | 162 | 20 | 171 | NAC domain-containing protein 19 |
4dul_A | 5e-62 | 10 | 162 | 17 | 168 | NAC domain-containing protein 19 |
4dul_B | 5e-62 | 10 | 162 | 17 | 168 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | SapurV1A.0063s0610.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC182709 | 1e-122 | AC182709.2 Populus trichocarpa clone Pop1-85D11, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002315038.1 | 1e-150 | NAC transcription factor 29 | ||||
Swissprot | K4BNG7 | 1e-111 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
TrEMBL | B9HXY0 | 1e-148 | B9HXY0_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0010s17350.1 | 1e-149 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4103 | 32 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69490.1 | 1e-108 | NAC-like, activated by AP3/PI |
Link Out ? help Back to Top | |
---|---|
Phytozome | SapurV1A.0063s0610.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|