PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_02406.1_g00004.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 228aa MW: 25370.7 Da PI: 10.1766 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 102.7 | 3.4e-32 | 117 | 173 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R+RgsgGrF Rsa1.0_02406.1_g00004.1 117 NEPMFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRARGSGGRF 173 59****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 2.0E-36 | 115 | 176 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 37.155 | 116 | 176 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 8.8E-27 | 118 | 173 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 4.6E-23 | 119 | 141 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 121 | 141 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 4.6E-23 | 150 | 173 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MMMPCSMKRS GLQLQDQDSS STQSTGEESG GGYMVSPHGK AIASYCKSTT TSSSMVSQDS 60 VFPPPASGWS LQCPETSHLN NFLAPEYYAS QPTVVAHVEM MGLVTSRVPL PHNYQENEPM 120 FVNAKQYHAI LRRRKHRAKL EAQNKLIKSR KPYLHESRHL HALKRARGSG GRFLNTKKKL 180 QESSKSLCSS SITPRSDSDR DNMFQNPSFR FSGYPSTTHH VSALMSGT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-21 | 117 | 195 | 2 | 78 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Involved in the blue light (BL) and abscisic acid (ABA) signaling pathways. {ECO:0000250, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_02406.1_g00004.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC787684 | 3e-79 | KC787684.1 Brassica napus transcription factor subunit NF-YA5B (NF-YA5B) gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018489439.1 | 1e-169 | PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1 | ||||
Refseq | XP_018489440.1 | 1e-169 | PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1 | ||||
Refseq | XP_018489441.1 | 1e-169 | PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1 | ||||
Refseq | XP_018489443.1 | 1e-169 | PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1 | ||||
Refseq | XP_018489444.1 | 1e-169 | PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1 | ||||
Swissprot | Q9SYH4 | 1e-105 | NFYA5_ARATH; Nuclear transcription factor Y subunit A-5 | ||||
TrEMBL | A0A078GNE1 | 1e-108 | A0A078GNE1_BRANA; BnaC06g10580D protein | ||||
TrEMBL | A0A0D3CSB3 | 1e-108 | A0A0D3CSB3_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g050970.1 | 1e-109 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM11633 | 17 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54160.1 | 4e-88 | nuclear factor Y, subunit A5 |