PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00930.1_g00003.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 104aa MW: 11543.5 Da PI: 10.4205 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 56 | 5.4e-18 | 11 | 40 | 1 | 30 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyy 30 Cs C+ttkTp+WR gp+g+k+LCnaCG++ Rsa1.0_00930.1_g00003.1 11 CSDCKTTKTPMWRGGPSGPKSLCNACGIRV 40 ****************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 1.38E-13 | 5 | 44 | No hit | No description |
SMART | SM00401 | 6.2E-13 | 5 | 61 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.097 | 5 | 38 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.1E-15 | 9 | 44 | IPR013088 | Zinc finger, NHR/GATA-type |
PROSITE pattern | PS00344 | 0 | 11 | 36 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 1.0E-15 | 11 | 40 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 2.21E-9 | 11 | 39 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 104 aa Download sequence Send to blast |
MEGEKETVRY CSDCKTTKTP MWRGGPSGPK SLCNACGIRV MRQRRSELLG IRIVHSHKAY 60 KKINTSSTLS SHGGVSLKKR RRSLMEEEQA ALCLLLLSCG SVFA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00930.1_g00003.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018455769.1 | 4e-71 | PREDICTED: GATA transcription factor 23 | ||||
Swissprot | Q8LC59 | 3e-36 | GAT23_ARATH; GATA transcription factor 23 | ||||
TrEMBL | A0A0D3E165 | 1e-57 | A0A0D3E165_BRAOL; Uncharacterized protein | ||||
STRING | Bo9g010700.1 | 2e-58 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14484 | 16 | 22 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26930.1 | 5e-36 | GATA transcription factor 23 |
Publications ? help Back to Top | |||
---|---|---|---|
|