PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Rsa1.0_00301.1_g00002.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 186aa MW: 21643.8 Da PI: 6.0125 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 43.3 | 7.7e-14 | 72 | 121 | 5 | 54 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 +++rr+ +NRe+ArrsR RK+ ++eL v+ L +eN++L ++l++ ++ Rsa1.0_00301.1_g00002.1 72 RKQRRMVSNRESARRSRMRKQRHLDELLSQVAWLRSENQQLLDKLNQASD 121 689***************************************99998765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 3.0E-11 | 68 | 132 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.657 | 70 | 118 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 9.3E-11 | 71 | 123 | No hit | No description |
SuperFamily | SSF57959 | 9.38E-13 | 72 | 122 | No hit | No description |
Pfam | PF00170 | 1.3E-11 | 72 | 122 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 5.43E-18 | 73 | 120 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 75 | 90 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MQPYYDSSSL NNMQQQDYFH LNHYYNNLNS STNTNNLIPY PQIQELNLQS PASNNSTTSD 60 EATEDIFVIN ERKQRRMVSN RESARRSRMR KQRHLDELLS QVAWLRSENQ QLLDKLNQAS 120 DSNNLAIQEN LSLKEENLEL RQVITSMKKL KGSTSIQGRY CSSSVDHELD QDFSCITDDP 180 RICHPS |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 84 | 91 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00512 | DAP | Transfer from AT5G15830 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Rsa1.0_00301.1_g00002.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC240087 | 0.0 | AC240087.1 Brassica oleracea clone BOT01-44D22, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018468262.1 | 1e-133 | PREDICTED: basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 3e-30 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A0D3AJ97 | 1e-114 | A0A0D3AJ97_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6DK54 | 1e-114 | A0A3P6DK54_BRAOL; Uncharacterized protein | ||||
STRING | Bo2g012800.1 | 1e-115 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10632 | 15 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G15830.1 | 1e-83 | basic leucine-zipper 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|