PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | RrC53936_p1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 158aa MW: 17419.3 Da PI: 9.9403 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 127.8 | 3.2e-40 | 34 | 94 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s RrC53936_p1 34 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNAKRS 94 5789*****************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 1.3E-33 | 36 | 92 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 4.0E-26 | 38 | 93 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.394 | 38 | 92 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 40 | 76 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MQDPSAYYQS MMSTQQHHQQ QQQQQQKQPQ QFPEQEQLKC PRCDSPNTKF CYYNNYNLSQ 60 PRHFCKSCRR YWTKGGALRN VPVGGGSRKN AKRSTSSSSP VNTHNKKTKH PDPGPNTDTD 120 PTRMLYGFPI GDQGVKGMEM GGGGGGGGGG GSFSSLLA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189344 | 8e-70 | AC189344.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042J11, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018489237.1 | 2e-79 | PREDICTED: dof zinc finger protein DOF3.1-like | ||||
Swissprot | Q94AR6 | 7e-61 | DOF31_ARATH; Dof zinc finger protein DOF3.1 | ||||
TrEMBL | A0A078J3C7 | 1e-72 | A0A078J3C7_BRANA; BnaCnng31430D protein | ||||
TrEMBL | A0A3P6ELC6 | 1e-72 | A0A3P6ELC6_BRAOL; Uncharacterized protein | ||||
STRING | XP_006406292.1 | 3e-69 | (Eutrema salsugineum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1269 | 28 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G21270.1 | 3e-51 | DOF zinc finger protein 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|