PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G21270.1

Common Name

ADOF2, DOF2, DOF3.1, MXL8.14

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Dof

Protein Properties

Length: 204aa MW: 22530 Da PI: 9.5985

Description

DOF zinc finger protein 2

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G21270.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	126.3	9.2e-40	25	84	2	61
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn ++ AT3G21270.1 25 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNATK 84 5789****************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF02701	1.9E-33	27	83	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.255	29	83	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	3.0E-23	29	77	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	31	67	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 204 aa Download sequence Send to blast
MQDPAAYYQT MMAKQQQQQQ PQFAEQEQLK CPRCDSPNTK FCYYNNYNLS QPRHFCKSCR 60 RYWTKGGALR NVPVGGGSRK NATKRSTSSS SSASSPSNSS QNKKTKNPDP DPDPRNSQKP 120 DLDPTRMLYG FPIGDQDVKG MEIGGSFSSL LANNMQLGLG GGGIMLDGSG WDHPGMGLGL 180 RRTEPGNNNN NPWTDLAMNR AEKN

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.257	0.0	flower\| inflorescence

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	258044_at	0.0
Expression Atlas	AT3G21270	-
AtGenExpress	AT3G21270	-
ATTED-II	AT3G21270	-

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes Dof zinc finger protein adof2.
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G21270.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G21270

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB017565	0.0	AB017565.1 Arabidopsis thaliana adof2 mRNA for Dof zinc finger protein, complete cds.
GenBank	AB023045	0.0	AB023045.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MXL8.
GenBank	AY150391	0.0	AY150391.1 Arabidopsis thaliana Dof zinc finger protein (At3g21270) mRNA, complete cds.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_188764.1	1e-151	DOF zinc finger protein 2
Swissprot	Q94AR6	1e-152	DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBL	A0A178VA07	1e-149	A0A178VA07_ARATH; DOF2
STRING	AT3G21270.1	1e-150	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1269	28	96
Representative plant	OGRP38	17	445

Link Out ? help Back to Top
Phytozome	AT3G21270.1
Entrez Gene	821681
iHOP	AT3G21270
wikigenes	AT3G21270

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yanagisawa S The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] Park DH, et al. The Arabidopsis COG1 gene encodes a Dof domain transcription factor and negatively regulates phytochrome signaling. Plant J., 2003. 34(2): p. 161-71 [PMID:12694592] Lijavetzky D,Carbonero P,Vicente-Carbajosa J Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Wang XJ,Cao XL,Hong Y Isolation and characterization of flower-specific transcripts in Acacia mangium. Tree Physiol., 2005. 25(2): p. 167-78 [PMID:15574398] Penfield S,Graham S,Graham IA Storage reserve mobilization in germinating oilseeds: Arabidopsis as a model system. Biochem. Soc. Trans., 2005. 33(Pt 2): p. 380-3 [PMID:15787611] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Gardiner J,Sherr I,Scarpella E Expression of DOF genes identifies early stages of vascular development in Arabidopsis leaves. Int. J. Dev. Biol., 2010. 54(8-9): p. 1389-96 [PMID:20563990] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]