PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Prupe.5G146100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 265aa MW: 29871.6 Da PI: 7.9978 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 158.3 | 3.2e-49 | 45 | 169 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+ev+++ ++PwdLp e+e yfFs++++ky++g+r+nr+t+sgyWkatg+dk+ Prupe.5G146100.1.p 45 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEVNVCMYDPWDLPGD---LEQERYFFSNKESKYRNGSRANRVTSSGYWKATGTDKK 131 79****************************.89***************54...46799********************************* PP NAM 92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++s+ +++ vg kktLvfy+g+ap+g ktdWvmhey l Prupe.5G146100.1.p 132 IVSSrRNHIVGKKKTLVFYRGKAPNGCKTDWVMHEYCL 169 *99867778***************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 4.84E-58 | 34 | 199 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.975 | 45 | 199 | IPR003441 | NAC domain |
Pfam | PF02365 | 8.4E-25 | 46 | 169 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 265 aa Download sequence Send to blast |
MVARHSSSQL TEAIKNQEKG FHFCFCFCFS TMDKFNFVRN GMIRLPPGFR FQPTDEELVF 60 QYLRCKVFSC PLPASIIPEV NVCMYDPWDL PGDLEQERYF FSNKESKYRN GSRANRVTSS 120 GYWKATGTDK KIVSSRRNHI VGKKKTLVFY RGKAPNGCKT DWVMHEYCLV NAETTASINT 180 AENALNEKEN WVLCRIFSKK RSCKTDDEEG IRVNNAEMVH APQTNNNQSP VSSSSSCSSS 240 SGITEVTSSS EAGDEEEISG CTKF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-47 | 43 | 204 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-47 | 43 | 204 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-47 | 43 | 204 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-47 | 43 | 204 | 15 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
3swm_B | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
3swm_C | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
3swm_D | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
3swp_A | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
3swp_B | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
3swp_C | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
3swp_D | 3e-47 | 43 | 204 | 18 | 173 | NAC domain-containing protein 19 |
4dul_A | 3e-47 | 43 | 204 | 15 | 170 | NAC domain-containing protein 19 |
4dul_B | 3e-47 | 43 | 204 | 15 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Prupe.5G146100.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007211149.2 | 0.0 | NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 1e-76 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A251PA18 | 0.0 | A0A251PA18_PRUPE; Uncharacterized protein | ||||
STRING | EMJ12348 | 1e-174 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 3e-78 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Prupe.5G146100.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|