PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.002G128900.1 | ||||||||
Common Name | POPTR_0002s13030g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 238aa MW: 26308.4 Da PI: 7.41 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54.9 | 2e-17 | 37 | 82 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W+ eEd +l +v+++G+++W++I+r++ gR++k+c++rw + Potri.002G128900.1 37 KGPWSSEEDMILTGLVERHGPKNWSLISRYIK-GRSGKSCRLRWCNQ 82 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 53.3 | 6.4e-17 | 91 | 133 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ Potri.002G128900.1 91 PFSPAEDEAILVAHARYGNR-WATIARLLP-GRTDNAVKNHWNST 133 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.687 | 32 | 83 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.19E-31 | 35 | 130 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.6E-14 | 36 | 85 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.4E-16 | 37 | 82 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.7E-23 | 38 | 90 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.46E-13 | 39 | 81 | No hit | No description |
PROSITE profile | PS51294 | 23.675 | 84 | 138 | IPR017930 | Myb domain |
SMART | SM00717 | 7.1E-15 | 88 | 136 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.0E-22 | 91 | 137 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.5E-14 | 91 | 133 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.97E-12 | 91 | 134 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
METMNMCSTS SSDSSASESS FNDNKTPRST DKSARIKGPW SSEEDMILTG LVERHGPKNW 60 SLISRYIKGR SGKSCRLRWC NQLSPNVEHR PFSPAEDEAI LVAHARYGNR WATIARLLPG 120 RTDNAVKNHW NSTLKRRARQ RQSQMNLEGN FDSNYGNNYE CIDINMTPGS MADGMVREEE 180 DALTALTLAP PGIGGAVCGS NGGMVVERTA ESLPAGFWDV MRDVIAREVR EYVSSTL* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 2e-40 | 36 | 138 | 3 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 7e-40 | 36 | 138 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 7e-40 | 36 | 138 | 57 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 2e-40 | 36 | 138 | 3 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 2e-40 | 36 | 138 | 3 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 133 | 139 | LKRRARQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.002G128900.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002301201.1 | 1e-177 | transcription factor MYB73 | ||||
Swissprot | O23160 | 9e-55 | MYB73_ARATH; Transcription factor MYB73 | ||||
TrEMBL | B9GNY7 | 1e-176 | B9GNY7_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0002s13030.1 | 1e-177 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5074 | 32 | 56 | Representative plant | OGRP5 | 17 | 1784 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 9e-57 | myb domain protein 73 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.002G128900.1 |
Entrez Gene | 7462900 |
Publications ? help Back to Top | |||
---|---|---|---|
|