PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Potri.001G235500.2 | ||||||||
Common Name | POPTR_0001s24220g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 179aa MW: 19800.9 Da PI: 4.8933 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 52.3 | 1.4e-16 | 2 | 43 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++ Potri.001G235500.2 2 TPQEERLVLELHAKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43 9*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 6.5E-12 | 1 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.25E-13 | 1 | 43 | No hit | No description |
PROSITE profile | PS51294 | 25.466 | 1 | 47 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-20 | 2 | 44 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 8.58E-13 | 2 | 48 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 7.3E-15 | 2 | 42 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MTPQEERLVL ELHAKWGNRW SRIARKLPGR TDNEIKNYWR THMRKKAQER KGAMSPSLSS 60 SNCSSSSNTT TVNSSPLPRT GETSFYDTGG LEQVALAGKN SEAVQGGEKG YSMDDIWKDI 120 ENTIEPVCDG FSEKGCNFSC PSLASPSWDY FPDTLWGFGE EEGKIFLPYD DGTTILTG* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pth.2779 | 1e-140 | stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Potri.001G235500.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB573751 | 4e-38 | AB573751.1 Lupinus albus LaMYB28 mRNA for R2R3-MYB transcription factor, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002298375.1 | 1e-130 | transcription factor MYB48 isoform X2 | ||||
Refseq | XP_024453164.1 | 1e-130 | transcription factor MYB48 isoform X1 | ||||
Swissprot | Q9LX82 | 1e-49 | MYB48_ARATH; Transcription factor MYB48 | ||||
TrEMBL | A0A2K2C2I7 | 1e-130 | A0A2K2C2I7_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0001s24220.1 | 1e-129 | (Populus trichocarpa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G46130.2 | 1e-50 | myb domain protein 48 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Potri.001G235500.2 |
Entrez Gene | 7485724 |
Publications ? help Back to Top | |||
---|---|---|---|
|