PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.011G035700.1 | ||||||||
Common Name | PHAVU_011G035700g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 266aa MW: 28753.2 Da PI: 6.415 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 27.9 | 5.3e-09 | 87 | 135 | 3 | 51 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 e k +r N+eA r++R++Kka+ + Le++v +L a N+ L k+l++ Phvul.011G035700.1 87 EKKSKKRPLGNKEAVRKYREKKKARAASLEDEVVKLRALNQHLMKKLQS 135 5688899999***********************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.8E-13 | 83 | 153 | No hit | No description |
SMART | SM00338 | 2.1E-10 | 85 | 152 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 8.875 | 87 | 153 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 1.4E-11 | 87 | 136 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 6.88E-7 | 89 | 136 | No hit | No description |
CDD | cd14686 | 8.88E-11 | 91 | 144 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0071294 | Biological Process | cellular response to zinc ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 266 aa Download sequence Send to blast |
MDDGELDFST HEVFSSPNMG ELPSSGSMDS FFDELLKDTH ACTHTHTCNP PGPDFSHTHT 60 CYHVHTKIVP APAEDQVATD DTAESAEKKS KKRPLGNKEA VRKYREKKKA RAASLEDEVV 120 KLRALNQHLM KKLQSQAGLE AEIARLKCLL VDIRGRIEGE IGSFPYQKSP NANPPAVNLP 180 GSYVMNPCNM QCDDRVYCGA DGRIVENVSL DGEEFGGCEF ENLQCLANQN LGLKELRACG 240 AGQAGSNVNS SASKRKGGSR AATAS* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporters ZIP3, ZIP4, ZIP5 and ZIP9 during growth in zinc-deficient conditions. ZIP9 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. | |||||
UniProt | Transcription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.011G035700.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. | |||||
UniProt | INDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015039 | 0.0 | AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007131714.1 | 0.0 | hypothetical protein PHAVU_011G035700g | ||||
Refseq | XP_007131715.1 | 0.0 | hypothetical protein PHAVU_011G035700g | ||||
Swissprot | Q8GTS2 | 1e-110 | BZP23_ARATH; Basic leucine zipper 23 | ||||
Swissprot | Q8VY76 | 1e-110 | BZP19_ARATH; Basic leucine zipper 19 | ||||
TrEMBL | V7AFW2 | 0.0 | V7AFW2_PHAVU; Uncharacterized protein | ||||
STRING | XP_007131714.1 | 0.0 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2567 | 32 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G16770.1 | 2e-99 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.011G035700.1 |
Entrez Gene | 18615057 |
Publications ? help Back to Top | |||
---|---|---|---|
|