PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.009G073800.1 | ||||||||
Common Name | PHAVU_009G073800g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 138aa MW: 15864.2 Da PI: 10.5797 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 32.9 | 1.4e-10 | 55 | 102 | 3 | 50 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 e k+ rr+q+NRe+ArrsR +Kk+ +e+L+ + L +N+ Lk+++ Phvul.009G073800.1 55 EEKKVRRMQSNRESARRSRYKKKKHLENLTSQMNRLRIQNRFLKNRVA 102 67999************************************9997765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.3E-10 | 50 | 104 | No hit | No description |
SMART | SM00338 | 3.9E-10 | 53 | 124 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF07716 | 4.7E-9 | 54 | 102 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.036 | 55 | 102 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 1.0E-10 | 57 | 111 | No hit | No description |
CDD | cd14702 | 1.16E-15 | 58 | 108 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 60 | 75 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 138 aa Download sequence Send to blast |
MLFHEAVQFP CSPVHHTMLT ESEIEDLFSL INKSRDPASL LSGSQGSNRT VYSSEEKKVR 60 RMQSNRESAR RSRYKKKKHL ENLTSQMNRL RIQNRFLKNR VASTMHQHLL LSLHNDHLKS 120 EAISLMATLS DLCGLLF* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.009G073800.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015035 | 1e-151 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007136783.1 | 2e-96 | hypothetical protein PHAVU_009G073800g | ||||
TrEMBL | V7AT00 | 4e-95 | V7AT00_PHAVU; Uncharacterized protein | ||||
STRING | XP_007136783.1 | 6e-96 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5996 | 30 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 6e-17 | basic leucine-zipper 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.009G073800.1 |
Entrez Gene | 18619422 |