PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Phvul.001G029500.1 | ||||||||
Common Name | PHAVU_001G029500g | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 141aa MW: 16594.9 Da PI: 11.0402 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 30.8 | 6.2e-10 | 57 | 101 | 5 | 49 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 ++ rr+q+NRe+ArrsR RKk +e+L++ + eN++Lk++l Phvul.001G029500.1 57 RKLRRMQSNRESARRSRWRKKRHLENLTNQQNRFRMENRELKNRL 101 5789**************************************876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 3.3E-6 | 52 | 101 | No hit | No description |
SMART | SM00338 | 1.4E-7 | 53 | 117 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.611 | 55 | 101 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.2E-7 | 57 | 101 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.74E-10 | 57 | 109 | No hit | No description |
CDD | cd14702 | 1.05E-12 | 58 | 107 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 60 | 75 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 141 aa Download sequence Send to blast |
MFFHQEPEPV HSSCFPVLQT MFTPAEIEEL FSLVNEPPSP ESGSQGSNRA VRSTHERKLR 60 RMQSNRESAR RSRWRKKRHL ENLTNQQNRF RMENRELKNR LFLTMHQNLL LSVENERLRS 120 ESLTLMATLS NLYQILGISQ * |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Phvul.001G029500.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP015036 | 1e-141 | AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007160935.1 | 7e-97 | hypothetical protein PHAVU_001G029500g | ||||
TrEMBL | V7CS18 | 2e-95 | V7CS18_PHAVU; Uncharacterized protein | ||||
STRING | XP_007160935.1 | 3e-96 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5996 | 30 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49760.1 | 2e-18 | basic leucine-zipper 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Phvul.001G029500.1 |
Entrez Gene | 18640207 |