PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf02382g04034.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 154aa MW: 17774.2 Da PI: 9.7565 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.3 | 5.6e-32 | 75 | 133 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk++++prsYYrCt+++C+vkk+++r ++d+++v++tYeg Hnh+ Peinf101Scf02382g04034.1 75 LDDGYKWRKYGQKAVKNNRHPRSYYRCTYHTCNVKKQIQRLSKDTTIVVTTYEGIHNHP 133 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 8.2E-33 | 62 | 133 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.15E-28 | 68 | 134 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.529 | 70 | 135 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.4E-36 | 75 | 134 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.6E-25 | 76 | 133 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MPIQNSSTLG LDINDWVNGL LSSPIIDNHD HPTTVGDQQN SSSCLIRNKG NKVIGKEKYV 60 PPRISFQTRS SEDILDDGYK WRKYGQKAVK NNRHPRSYYR CTYHTCNVKK QIQRLSKDTT 120 IVVTTYEGIH NHPCDKLMET LSPLLKQLQF LPRF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-24 | 65 | 132 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 2e-24 | 65 | 132 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975447 | 2e-52 | HG975447.1 Solanum pennellii chromosome ch08, complete genome. | |||
GenBank | HG975520 | 2e-52 | HG975520.1 Solanum lycopersicum chromosome ch08, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016552679.1 | 3e-64 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_019160501.1 | 2e-64 | PREDICTED: probable WRKY transcription factor 43 | ||||
Swissprot | Q8VWQ4 | 1e-55 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
TrEMBL | A0A1U8F8W7 | 6e-63 | A0A1U8F8W7_CAPAN; probable WRKY transcription factor 75 | ||||
TrEMBL | A0A2G3ADM1 | 4e-63 | A0A2G3ADM1_CAPAN; Putative WRKY transcription factor 56 | ||||
STRING | XP_009598201.1 | 7e-62 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6374 | 24 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G64000.1 | 5e-58 | WRKY DNA-binding protein 56 |