PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00877g03014.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 91aa MW: 10095.2 Da PI: 4.6285 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 36 | 1.6e-11 | 39 | 79 | 4 | 46 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +++eE++l+++ ++ G + W++Ia +++ gR+++++ +w++ Peinf101Scf00877g03014.1 39 FSEEEEDLIIRMYNLVGER-WSLIAGRIP-GRSAEEIEKYWNT 79 89*****************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.893 | 31 | 85 | IPR017930 | Myb domain |
SMART | SM00717 | 6.7E-9 | 35 | 83 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.5E-11 | 39 | 79 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.35E-9 | 39 | 80 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 4.9E-15 | 39 | 79 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.57E-7 | 45 | 79 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MADKGQSSSS VNTPADSQDG VAPRMLVSGK TSKVAEIEFS EEEEDLIIRM YNLVGERWSL 60 IAGRIPGRSA EEIEKYWNTR SSTSQSLTMP R |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF985022 | 1e-134 | KF985022.1 Petunia x hybrida cultivar Mitchell R3-MYB anthocyanin repressor (MYBx) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009607344.1 | 6e-33 | PREDICTED: MYB-like transcription factor ETC1 | ||||
Refseq | XP_016481564.1 | 6e-33 | PREDICTED: MYB-like transcription factor ETC1 | ||||
Swissprot | Q9LNI5 | 7e-18 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A023PIT6 | 7e-54 | A0A023PIT6_PETHY; R3-MYB anthocyanin repressor | ||||
STRING | XP_009607344.1 | 2e-32 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6579 | 19 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 3e-17 | MYB_related family protein |