PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peinf101Scf00674g07017.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 216aa MW: 24203.5 Da PI: 7.9048 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 227.4 | 3.9e-70 | 13 | 180 | 2 | 170 |
YABBY 2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkee....lleelkveeenl 82 d+ seq+CyvqCn C+t+lavsvP tslfk+vtvrCGhCt+ll vn+++ +a++h + ++ ++ + +l e +n Peinf101Scf00674g07017.1 13 DHLPPSEQLCYVQCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRVLL--PSANHHHQLHFGHSyfspSH-NLLEEITNA 94 577899****************************************8876654..44444444444444333222.233333333 PP YABBY 83 ksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkih 167 + n +++s+st+ + +++pr+p ++rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+i Peinf101Scf00674g07017.1 95 TPNFLMNQSNSTDFVLP--ARTGFDDLPRPPVINRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIQ 177 33333333333333332..4667899***999***************************************************** PP YABBY 168 fgl 170 fgl Peinf101Scf00674g07017.1 178 FGL 180 *97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 2.5E-69 | 17 | 180 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 3.8E-8 | 124 | 174 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 7.5E-5 | 128 | 174 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 216 aa Download sequence Send to blast |
MSSSTPNSTL SLDHLPPSEQ LCYVQCNICD TVLAVSVPCT SLFKTVTVRC GHCTNLLPVN 60 MRVLLPSANH HHQLHFGHSY FSPSHNLLEE ITNATPNFLM NQSNSTDFVL PARTGFDDLP 120 RPPVINRPPE KRQRVPSAYN RFIKEEIQRI KAGNPDISHR EAFSAAAKNW AHFPHIQFGL 180 MPDQTVKKTN LRQQDGEDVL MKDGLFTSAN VSVSPY |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. Regulates the initiation of embryonic shoot apical meristem (SAM) development (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6, PubMed:19837869). Required during flower formation and development, particularly for the patterning of floral organs. Positive regulator of class B (AP3 and PI) activity in whorls 2 and 3. Negative regulator of class B activity in whorl 1 and of SUP activity in whorl 3. Interacts with class A proteins (AP1, AP2 and LUG) to repress class C (AG) activity in whorls 1 and 2. Contributes to the repression of KNOX genes (STM, KNAT1/BP and KNAT2) to avoid ectopic meristems. Binds DNA without sequence specificity. In vitro, can compete and displace the AP1 protein binding to DNA containing CArG box (PubMed:10323860, PubMed:10331982, PubMed:10457020, PubMed:11812777, PubMed:12417699, PubMed:9878633, Ref.3, Ref.6). {ECO:0000269|PubMed:10323860, ECO:0000269|PubMed:10331982, ECO:0000269|PubMed:10457020, ECO:0000269|PubMed:11812777, ECO:0000269|PubMed:12417699, ECO:0000269|PubMed:19837869, ECO:0000269|PubMed:9878633, ECO:0000269|Ref.3, ECO:0000269|Ref.6}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ667760 | 0.0 | KJ667760.1 Solanum sisymbriifolium YAB1 protein mRNA, complete cds. | |||
GenBank | KJ667761 | 0.0 | KJ667761.1 Solanum aethiopicum YAB1 protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009781194.1 | 1e-142 | PREDICTED: protein YABBY 4-like | ||||
Refseq | XP_016477431.1 | 1e-142 | PREDICTED: protein YABBY 4-like | ||||
Swissprot | O22152 | 3e-82 | YAB1_ARATH; Axial regulator YABBY 1 | ||||
TrEMBL | A0A1S4AL86 | 1e-141 | A0A1S4AL86_TOBAC; protein YABBY 4-like | ||||
TrEMBL | A0A1U7X2T9 | 1e-141 | A0A1U7X2T9_NICSY; protein YABBY 4-like | ||||
STRING | XP_009781194.1 | 1e-141 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA381 | 24 | 163 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45190.1 | 1e-84 | YABBY family protein |