PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf16989g00001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 82aa MW: 9409.15 Da PI: 4.3217 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 60.7 | 3.4e-19 | 1 | 47 | 51 | 97 |
NF-YB 51 sdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 sdkc++e+r+t+ngdd++wal++lGf+ y+e++ yl k re+e+++ Peaxi162Scf16989g00001.1 1 SDKCHKENRRTVNGDDICWALSSLGFDSYAEAMIRYLYKLREFERQR 47 89******************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 6.8E-19 | 1 | 73 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.79E-15 | 2 | 70 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 9.5E-7 | 4 | 22 | No hit | No description |
PRINTS | PR00615 | 9.5E-7 | 23 | 41 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
SDKCHKENRR TVNGDDICWA LSSLGFDSYA EAMIRYLYKL REFERQRANQ SKGSFNDDED 60 TDDEATSESE KQETTLSPPA PL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019233101.1 | 4e-43 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 9e-21 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A1J6KBZ1 | 1e-41 | A0A1J6KBZ1_NICAT; Nuclear transcription factor y subunit b-4 | ||||
STRING | XP_009760265.1 | 2e-39 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G09030.1 | 1e-22 | nuclear factor Y, subunit B4 |
Publications ? help Back to Top | |||
---|---|---|---|
|