PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Peaxi162Scf00580g00710.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 132aa MW: 15288.5 Da PI: 10.5941 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 135.5 | 3.6e-42 | 7 | 132 | 2 | 125 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 pGfrFhPt+eelv++yLk++++++kl+ ++vi v+iy ++Pw+Lp ++ +e+ew+f ++r++k+ + +++r+ ++g+Wkat Peaxi162Scf00580g00710.1 7 LPGFRFHPTEEELVNFYLKRSIKDNKLPDSNVIGFVNIYLHDPWELPGLARLGEREWHFLVPRNRKHGPKGKPSRTSRNGFWKAT 91 59*************************9999****************8778899******************************* PP NAM 87 gkdkevlsk..kgelvglkktLvfykgrapkgektdWvmhe 125 g+d ++ s+ ++++glkktLvfy+grapkg++tdWvm+e Peaxi162Scf00580g00710.1 92 GTDSQIRSSidLKKVIGLKKTLVFYSGRAPKGSRTDWVMNE 132 *******99877888************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 7.45E-43 | 5 | 132 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.073 | 6 | 132 | IPR003441 | NAC domain |
Pfam | PF02365 | 5.3E-22 | 8 | 132 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
MSLDEHLPGF RFHPTEEELV NFYLKRSIKD NKLPDSNVIG FVNIYLHDPW ELPGLARLGE 60 REWHFLVPRN RKHGPKGKPS RTSRNGFWKA TGTDSQIRSS IDLKKVIGLK KTLVFYSGRA 120 PKGSRTDWVM NE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 5e-38 | 8 | 132 | 17 | 137 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016509571.1 | 3e-75 | PREDICTED: putative NAC domain-containing protein 94 isoform X2 | ||||
Swissprot | Q10S65 | 3e-60 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | A0A1S4D881 | 8e-74 | A0A1S4D881_TOBAC; putative NAC domain-containing protein 94 isoform X2 | ||||
STRING | XP_009606805.1 | 2e-74 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3531 | 22 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 1e-60 | NAC domain containing protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|