PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.1KG126100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 170aa MW: 18568.6 Da PI: 10.5634 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.8 | 3.1e-15 | 88 | 149 | 1 | 62 |
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke kr +r+ +NR++A+ R+RKka++ Le kvk Le+ N+++ ++l++l++e + l++ Pavir.1KG126100.1.p 88 DKEHKRLKRLLRNRVSAQQARERKKAYLTDLEVKVKDLEKNNSEMEEKLSTLQNENQMLRQI 149 5899*****************************************************99886 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.3E-14 | 88 | 152 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 4.7E-14 | 89 | 150 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 12.185 | 90 | 153 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.25E-13 | 92 | 150 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 2.2E-16 | 92 | 152 | No hit | No description |
CDD | cd14704 | 3.61E-15 | 93 | 144 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 95 | 110 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MQEQAASSRP SRSSSERSSS SAHHIDMEVK EGMESDEEIR RVPELGLELP GGASTSGREA 60 GAGAGGPERA QSSTAQASSR RRVRSPADKE HKRLKRLLRN RVSAQQARER KKAYLTDLEV 120 KVKDLEKNNS EMEEKLSTLQ NENQMLRQIL KNTTVSRRGP GSTAGGEGQ* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.13871 | 7e-77 | leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269|PubMed:15178762}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.1KG126100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT063353 | 1e-150 | BT063353.1 Zea mays full-length cDNA clone ZM_BFc0055M22 mRNA, complete cds. | |||
GenBank | KJ726945 | 1e-150 | KJ726945.1 Zea mays clone pUT3491 bZIP transcription factor (bZIP61) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004951525.1 | 1e-100 | transcription factor HY5 | ||||
Swissprot | Q9SM50 | 9e-54 | HY5_SOLLC; Transcription factor HY5 | ||||
TrEMBL | K3YW78 | 2e-98 | K3YW78_SETIT; Uncharacterized protein | ||||
STRING | Si018524m | 4e-99 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1408 | 38 | 111 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G11260.1 | 2e-39 | bZIP family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.1KG126100.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|