PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK19243.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 82aa MW: 9501.26 Da PI: 4.9502 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 45.5 | 2e-14 | 36 | 81 | 2 | 47 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkh 47 Fl k+y ++ed++++e+isw+++g++fvv+++ efa+++Lp+ F+h PK19243.2 36 FLLKTYMLVEDPATDEVISWNAQGTAFVVWQPAEFARDLLPTLFRH 81 9********************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 5.4E-16 | 29 | 81 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 2.65E-13 | 31 | 81 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.9E-4 | 32 | 82 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 3.1E-11 | 36 | 81 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.2E-7 | 36 | 59 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 2.2E-7 | 74 | 82 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
XNNNIDIMDH HNNDHVLISD QKGLLEYMRK SSPPPFLLKT YMLVEDPATD EVISWNAQGT 60 AFVVWQPAEF ARDLLPTLFR HX |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024189461.1 | 2e-36 | heat stress transcription factor B-3 | ||||
Swissprot | O22230 | 5e-24 | HSFB3_ARATH; Heat stress transcription factor B-3 | ||||
TrEMBL | A0A2P5EMY3 | 3e-36 | A0A2P5EMY3_TREOI; Heat shock transcription factor | ||||
STRING | XP_008244246.1 | 1e-35 | (Prunus mume) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1592 | 33 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G41690.1 | 2e-26 | heat shock transcription factor B3 |