PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01155840G0010 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 83aa MW: 8490.44 Da PI: 9.9959 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 98.8 | 3.5e-31 | 38 | 83 | 3 | 48 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrn 48 +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrn PH01155840G0010 38 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRN 83 57899****************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-23 | 35 | 83 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 2.5E-27 | 40 | 83 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 25.117 | 41 | 83 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 43 | 79 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 83 aa Download sequence Send to blast |
MAGAGGAAAA VQPAAAARSS SGSAGGGTGS GGVADPRAEA LRCPRCDSAN TKFCYYNNYS 60 LSQPRHFCKA CKRYWTRGGT LRN |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01155840G0010 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP003815 | 4e-70 | AP003815.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OJ1163_G04. | |||
GenBank | AP014963 | 4e-70 | AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004957815.1 | 1e-34 | dof zinc finger protein 2-like | ||||
Swissprot | Q9FZA4 | 3e-26 | DOF14_ARATH; Dof zinc finger protein DOF1.4 | ||||
TrEMBL | A0A3L6FP36 | 1e-34 | A0A3L6FP36_MAIZE; Dof zinc finger protein DOF1.4 | ||||
STRING | GRMZM2G064655_P01 | 3e-33 | (Zea mays) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP8895 | 30 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G28310.2 | 3e-28 | Dof family protein |