PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01001210G0270 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 201aa MW: 21525.8 Da PI: 8.5932 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 98.9 | 3.3e-31 | 112 | 170 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC+vkk+ver+++dp++v++tYeg Hnh PH01001210G0270 112 LDDGYRWRKYGKKSVKNSPNPRNYYRCSTEGCSVKKRVERDRDDPSYVVTTYEGIHNHV 170 59********************************************************5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.7E-33 | 97 | 171 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 5.62E-28 | 105 | 171 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.72 | 107 | 172 | IPR003657 | WRKY domain |
SMART | SM00774 | 9.6E-36 | 112 | 171 | IPR003657 | WRKY domain |
Pfam | PF03106 | 8.2E-25 | 113 | 169 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 201 aa Download sequence Send to blast |
MAYPPPRGGS SSSPYSSSSA ASLSPTFGAA LPGALHHQQQ HLDVLDYFSD EGGPSSVPGA 60 FGTPPPLMPV EPVVPDAGGY YANPRSAAAM AGEAGARTDR IAFRMRSEEE ILDDGYRWRK 120 YGKKSVKNSP NPRNYYRCST EGCSVKKRVE RDRDDPSYVV TTYEGIHNHV SPGTVYYAAQ 180 DAASGRFFVA GIGNQSRLAK * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 7e-25 | 103 | 172 | 8 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 7e-25 | 103 | 172 | 8 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01001210G0270 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK108555 | 8e-92 | AK108555.1 Oryza sativa Japonica Group cDNA clone:002-144-E10, full insert sequence. | |||
GenBank | AY870609 | 8e-92 | AY870609.1 Oryza sativa (japonica cultivar-group) WRKY26 mRNA, complete cds. | |||
GenBank | HQ858873 | 8e-92 | HQ858873.1 Oryza sativa Japonica Group isolate UT1750 WRKY transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003569675.1 | 1e-78 | WRKY transcription factor WRKY62 | ||||
Swissprot | Q93WU9 | 3e-39 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | I1HQX3 | 3e-77 | I1HQX3_BRADI; Uncharacterized protein | ||||
STRING | BRADI2G48090.1 | 5e-78 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-39 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|