PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_14366 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 132aa MW: 15377.2 Da PI: 9.679 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99 | 3e-31 | 27 | 85 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDg++WrKYG+K vk+s++pr+YYrC+s+gC vkk+ver+++dp++v+++Yeg+Hnh+ PEQU_14366 27 MDDGFKWRKYGKKAVKSSPNPRNYYRCSSSGCGVKKRVERDRNDPSYVITIYEGTHNHK 85 69********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.2E-33 | 14 | 87 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.75E-28 | 19 | 87 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 31.158 | 22 | 87 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.9E-33 | 27 | 86 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.8E-25 | 28 | 85 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 132 aa Download sequence Send to blast |
AEEVKRRKIE AAEYRIGFRT KSDVEIMDDG FKWRKYGKKA VKSSPNPRNY YRCSSSGCGV 60 KKRVERDRND PSYVITIYEG THNHKSPDES RHPYMSYEVP HSSSPWSSCA QIIPNLTPNF 120 TWNTQFAPFS YT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-27 | 17 | 87 | 7 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 6e-27 | 17 | 87 | 7 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020577278.1 | 2e-95 | probable WRKY transcription factor 50 | ||||
Swissprot | Q8VWQ5 | 3e-36 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
TrEMBL | A0A2I0B6D7 | 1e-48 | A0A2I0B6D7_9ASPA; Putative WRKY transcription factor 50 | ||||
STRING | GSMUA_Achr7P09680_001 | 9e-43 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G26170.1 | 1e-38 | WRKY DNA-binding protein 50 |
Publications ? help Back to Top | |||
---|---|---|---|
|