PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OGLUM05G18920.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 194aa MW: 20814.3 Da PI: 10.2297 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 46.8 | 6.4e-15 | 113 | 164 | 3 | 54 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 +++r++r++kNRe+A rsR+RK+a+i+eLe v+eLe+e +L e ee ++ OGLUM05G18920.1 113 AIQRQKRMIKNRESAARSRERKQAYIAELEAQVAELEEEHAQLLREQEEKNQ 164 789**************************************99977666544 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.2E-9 | 111 | 176 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 7.2E-13 | 112 | 164 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.841 | 113 | 161 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 8.17E-17 | 115 | 161 | No hit | No description |
SuperFamily | SSF57959 | 3.66E-11 | 116 | 162 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 2.3E-13 | 116 | 163 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 118 | 133 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 194 aa Download sequence Send to blast |
MASSRAAGPP VAEVAARRTA EEVWKEISSS GGLSAPAPAP AAGAAGRGGG PEMTLEDFLA 60 REDDPRATAV EGNMVVGFPN GTEGVGTAGG GRGGGGGGRG RKRTLMDPAD RAAIQRQKRM 120 IKNRESAARS RERKQAYIAE LEAQVAELEE EHAQLLREQE EKNQKRLKEI KEQAVAVVIR 180 KKTQDLRRTN SMEW |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 89 | 97 | GGRGGGGGG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00648 | PBM | Transfer from LOC_Os05g36160 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT834109 | 0.0 | CT834109.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA060C07, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015639395.1 | 1e-100 | bZIP transcription factor 12-like | ||||
Swissprot | Q0JHF1 | 6e-57 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | A0A0D9ZZQ8 | 1e-133 | A0A0D9ZZQ8_9ORYZ; Uncharacterized protein | ||||
STRING | OGLUM05G18920.1 | 1e-134 | (Oryza glumipatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2665 | 37 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G44080.1 | 2e-13 | bZIP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|