PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OB10G19740.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 170aa MW: 19368.6 Da PI: 5.1114 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 84.9 | 8.1e-27 | 48 | 99 | 3 | 55 |
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 rl Wt +LH++F+ av++L G++kA+Pk+il +m+vk Lt+e+v+SHLQkYR+ OB10G19740.1 48 RLSWTAQLHRQFIAAVKHL-GEDKAVPKKILGIMNVKHLTREQVASHLQKYRM 99 9******************.********************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.988 | 43 | 102 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 3.17E-19 | 45 | 103 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 7.5E-26 | 46 | 102 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 8.9E-25 | 48 | 101 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 6.0E-8 | 48 | 98 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048576 | Biological Process | positive regulation of short-day photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MAASSATDPA TTRTASEGST PLENEVRDDD MEHSNGEITD IRGLRECRLS WTAQLHRQFI 60 AAVKHLGEDK AVPKKILGIM NVKHLTREQV ASHLQKYRMR QKKSIPTASR SKCFDQDGCM 120 EITDYSLPKD DLSSGSECML EERKDYPSED LQDLQWDSDK QEYGPCLWNF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 2e-18 | 45 | 103 | 4 | 62 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that acts as floral inducer to promote short-day (SD) flowering pathway. Activates Hd3a and other FT-like genes independently from Hd1. May also activate MADS-box transcription factors involved in flowering regulation. {ECO:0000269|PubMed:15078816}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | OB10G19740.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Daily oscillation and diurnal expression in plants grown in short day (SD) but not in long day (LD) conditions. {ECO:0000269|PubMed:15078816}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006661837.1 | 1e-125 | PREDICTED: two-component response regulator EHD1-like | ||||
Swissprot | Q7Y0W3 | 2e-85 | EHD1_ORYSI; Two-component response regulator EHD1 | ||||
TrEMBL | J3N376 | 1e-125 | J3N376_ORYBR; Uncharacterized protein | ||||
STRING | OB10G19740.1 | 1e-125 | (Oryza brachyantha) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP11222 | 27 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16857.2 | 3e-20 | response regulator 1 |