PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf06916g01011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 150aa MW: 17361.1 Da PI: 10.0059 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 144.9 | 4.5e-45 | 9 | 135 | 3 | 128 |
NAM 3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 pGfrFhPt eel+++yLk+ ++g+ l+ +vi+ v+iy ++Pw+Lp ++ +e+ewyfF++ ++k+ + r+nr+t++g+Wkatg Niben101Scf06916g01011.1 9 PGFRFHPTAEELINFYLKRIIKGNLLDS-SVIAFVNIYLHDPWELPGLARIGEREWYFFVQLNRKHGPKGRPNRTTRNGFWKATG 92 9************************999.89***************8778899******************************** PP NAM 88 kdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128 +d ++ s+ +++++glkktLvfy grapkg +tdWvm+eyrl Niben101Scf06916g01011.1 93 SDCQIRSTldSKKVIGLKKTLVFYGGRAPKGCRTDWVMNEYRL 135 ******99988999***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51005 | 46.225 | 7 | 150 | IPR003441 | NAC domain |
SuperFamily | SSF101941 | 1.7E-48 | 8 | 140 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-24 | 9 | 135 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0045792 | Biological Process | negative regulation of cell size | ||||
GO:0048281 | Biological Process | inflorescence morphogenesis | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MSLPELELPG FRFHPTAEEL INFYLKRIIK GNLLDSSVIA FVNIYLHDPW ELPGLARIGE 60 REWYFFVQLN RKHGPKGRPN RTTRNGFWKA TGSDCQIRST LDSKKVIGLK KTLVFYGGRA 120 PKGCRTDWVM NEYRLPDGQS LPEVLSFYNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 4e-41 | 5 | 135 | 12 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds sequence-specific DNA motifs. Involved in stress response. Plays a positive role in drought and salt stress tolerance through the modulation of abscisic acid-mediated signaling. {ECO:0000269|PubMed:26834774}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by drought stress, salt stress and abscisic acid (ABA). {ECO:0000269|PubMed:26834774}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009757158.1 | 7e-96 | PREDICTED: putative NAC domain-containing protein 94 | ||||
Swissprot | Q10S65 | 5e-65 | NAC22_ORYSJ; NAC domain-containing protein 22 | ||||
TrEMBL | A0A1U7USG2 | 2e-94 | A0A1U7USG2_NICSY; putative NAC domain-containing protein 94 | ||||
STRING | XP_009757158.1 | 3e-95 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3531 | 22 | 48 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G17040.1 | 5e-67 | NAC domain containing protein 36 |
Publications ? help Back to Top | |||
---|---|---|---|
|