PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr8g099750.1 | ||||||||
Common Name | MTR_8g099750 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 228aa MW: 25747.8 Da PI: 8.134 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 148.3 | 3.8e-46 | 14 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrF+Ptdeelv +yLk k+ + +l++ ++i+ev+++k++PwdLp + +e+e +fFs+++ ky++++r +r+tk gyWkatg+dk++ s Medtr8g099750.1 14 LPPGFRFQPTDEELVFNYLKCKIFSCPLPA-SIIPEVNVCKYDPWDLPGGC--DEQERHFFSSKEAKYRNSNRMSRTTKCGYWKATGSDKKISS 104 79****************************.89***************544..77999***********************************9 PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 + + gl+ktLvfy+g++p+g++tdW++heyrl Medtr8g099750.1 105 StCNGIAGLRKTLVFYEGKSPNGSRTDWILHEYRL 139 8777789**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-52 | 10 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.141 | 14 | 167 | IPR003441 | NAC domain |
Pfam | PF02365 | 2.7E-23 | 15 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 228 aa Download sequence Send to blast |
MDKLNFIKNG VSRLPPGFRF QPTDEELVFN YLKCKIFSCP LPASIIPEVN VCKYDPWDLP 60 GGCDEQERHF FSSKEAKYRN SNRMSRTTKC GYWKATGSDK KISSSTCNGI AGLRKTLVFY 120 EGKSPNGSRT DWILHEYRLI NVETTNNSAQ NYGNEIGEWV LCRLSVRKRS GLEYGSTSTP 180 NSRLMFDFMM VNNKTCSSTS SSCSSSSNNI EVSSNVQDHE QDYADHF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 4e-42 | 14 | 168 | 15 | 169 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr8g099750.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003630552.1 | 1e-170 | NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 4e-69 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | G7LI31 | 1e-169 | G7LI31_MEDTR; NAC transcription factor-like protein | ||||
STRING | AET05028 | 1e-170 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 2e-70 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr8g099750.1 |
Entrez Gene | 11435779 |
Publications ? help Back to Top | |||
---|---|---|---|
|