PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr7g005280.1 | ||||||||
Common Name | MTR_7g005280 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 257aa MW: 28771.2 Da PI: 9.6179 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 166.6 | 8.6e-52 | 15 | 139 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+evd++k++PwdLp e+e yfFs+++ ky++g+r+nrat+sgyWkatg dk++++ Medtr7g005280.1 15 LPPGFRFHPTDEELVVQYLKRKVFSFPLPA-SIIPEVDLCKSDPWDLPGD---MEQERYFFSTKEAKYPNGNRSNRATNSGYWKATGLDKQIMN 104 79****************************.89***************54...46799***********************************9 PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 + ++e+ g+kktLvfy+g+ p+g++tdW+mheyrl Medtr7g005280.1 105 SkTHEVAGMKKTLVFYRGKPPHGSRTDWIMHEYRL 139 8567779**************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.23E-60 | 11 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.252 | 15 | 160 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.2E-27 | 16 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 257 aa Download sequence Send to blast |
MEKMNFVKKN GEVRLPPGFR FHPTDEELVV QYLKRKVFSF PLPASIIPEV DLCKSDPWDL 60 PGDMEQERYF FSTKEAKYPN GNRSNRATNS GYWKATGLDK QIMNSKTHEV AGMKKTLVFY 120 RGKPPHGSRT DWIMHEYRLT SSHSNPPLNE NWVLCRIFLK RRSGAKNGEE RVVKGLKPSS 180 GSNFGDEVKK NSASSSNSSS KVVVFYDFLA EKKNNNTDAS STSITISPAS SGITNELDEQ 240 ENEDSSKSLP SSFGNA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 4e-51 | 12 | 166 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 4e-51 | 12 | 166 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 4e-51 | 12 | 166 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 4e-51 | 12 | 166 | 14 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
3swm_B | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
3swm_C | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
3swm_D | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
3swp_A | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
3swp_B | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
3swp_C | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
3swp_D | 4e-51 | 12 | 166 | 17 | 174 | NAC domain-containing protein 19 |
4dul_A | 4e-51 | 12 | 166 | 14 | 171 | NAC domain-containing protein 19 |
4dul_B | 4e-51 | 12 | 166 | 14 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.7067 | 0.0 | glandular trichome| leaf| root| stem |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr7g005280.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | - | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT142269 | 0.0 | BT142269.1 Medicago truncatula clone JCVI-FLMt-5C10 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003620957.1 | 0.0 | NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 3e-93 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | G7KVL9 | 0.0 | G7KVL9_MEDTR; NAC transcription factor-like protein | ||||
STRING | AES77175 | 0.0 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 2e-90 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr7g005280.1 |
Entrez Gene | 11439439 |
Publications ? help Back to Top | |||
---|---|---|---|
|