PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr4g084550.1 | ||||||||
Common Name | MTR_4g084550 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 185aa MW: 21012.7 Da PI: 8.4059 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 68.5 | 8.1e-22 | 62 | 122 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 ++R+++t+ ql +Leel+++ ++psae+++++A++l +++ ++V++WFqN++a+e++ Medtr4g084550.1 62 SSRWSPTPVQLLVLEELYRQgMKTPSAEQIQQIASQLrqfgKIEGKNVFYWFQNHKARERQ 122 58*****************99**************************************97 PP | |||||||
2 | Wus_type_Homeobox | 115.5 | 2.5e-37 | 61 | 124 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 +++RW+Ptp Q+ +Leely++G++tP++e+iq+i+++L+++Gkie+kNVfyWFQN+kaRerqk+ Medtr4g084550.1 61 PSSRWSPTPVQLLVLEELYRQGMKTPSAEQIQQIASQLRQFGKIEGKNVFYWFQNHKARERQKR 124 689***********************************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 5.13E-14 | 57 | 126 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 11.612 | 58 | 123 | IPR001356 | Homeobox domain |
SMART | SM00389 | 3.9E-8 | 60 | 127 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.89E-6 | 61 | 124 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.1E-10 | 63 | 122 | IPR009057 | Homeodomain-like |
Pfam | PF00046 | 1.7E-19 | 63 | 122 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MSDSFCSFLS ATSNSNHNSH APSKITSIVQ PYCICTHCNH LLPFNHHLAE QGTSNIMHPQ 60 PSSRWSPTPV QLLVLEELYR QGMKTPSAEQ IQQIASQLRQ FGKIEGKNVF YWFQNHKARE 120 RQKRRRLEME ETTEDKKEKE KYVMGNSKKQ EGAETGGGVK ETKKWATTSN CSEQAEVCNF 180 SCLC* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 122 | 126 | KRRRL |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Specifically expressed during initiation of the shoot apical meristem, when cotyledonary primordia arise at the flanks of the apical embryo domain phase. Confined to the initiating vascular primordium of the cotyledons during heart and torpedo stages, but only weakly expressed during bent cotyledon stage. {ECO:0000269|PubMed:14711878}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor which may be involved in developmental processes. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr4g084550.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004505406.2 | 1e-84 | WUSCHEL-related homeobox 6 isoform X2 | ||||
Refseq | XP_012572552.1 | 1e-84 | WUSCHEL-related homeobox 6 isoform X1 | ||||
Swissprot | Q6X7K0 | 4e-35 | WOX1_ARATH; WUSCHEL-related homeobox 1 | ||||
TrEMBL | A0A072UYB2 | 1e-136 | A0A072UYB2_MEDTR; Wuschel-related homeobox protein | ||||
STRING | XP_004505406.1 | 8e-89 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF15154 | 10 | 12 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G18010.1 | 3e-35 | WUSCHEL related homeobox 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr4g084550.1 |
Entrez Gene | 25492991 |
Publications ? help Back to Top | |||
---|---|---|---|
|